GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Lipase member H

Summary

UniProt ID: Q6DBU8
Gene Symbol: liph zgc:91985
Gene ID: 445105
Organism: Danio rerio (zebrafish)

External Links

Re-Glyco: Q6DBU8

Annotation

Keyword: Cell membrane Disulfide bond Glycoprotein Hydrolase Lipid degradation Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
phosphatidic acid biosynthetic process	IEA	GO_REF
lipid catabolic process	IBA	GO_REF
lipid catabolic process	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

phosphatidic acid metabolic process [inference]

phosphatidic acid biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

organophosphate metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

phosphatidic acid metabolic process [inference]

phosphatidic acid biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

organophosphate biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

catabolic process [inference]

lipid catabolic process

biosynthetic process [inference]

lipid biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

glycerolipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

organophosphate biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

primary metabolic process [inference]

lipid metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

phosphatidic acid metabolic process [inference]

phosphatidic acid biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

lipid biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

glycerolipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

lipid catabolic process

glycerolipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

phosphatidic acid metabolic process [inference]

phosphatidic acid biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

glycerolipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidic acid biosynthetic process

Displaying **all 3** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
plasma membrane	ISS	GO_REF
plasma membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
glycerophospholipase activity	IBA	GO_REF
glycerophospholipase activity	IEA	GO_REF
heparin binding	IEA	GO_REF
carboxylic ester hydrolase activity	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

lipase activity [inference]

phospholipase activity [inference]

glycerophospholipase activity

carboxylic ester hydrolase activity

binding [inference]

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

heparin binding

sulfur compound binding [inference]

heparin binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MIYRKIIWGILYVTLMLFDTHRAQECEEMTDLNFKDSLAGTSLKVRLLLYTRADPSCGQLLSHQEPFSNSQFNVSSVTTFLIHGYRPTGSPPVWMKQFVEFLLNRRDMNVIVVDWNRGATNMNYWQVVKNTRKVANNLTDLIQKMKDNGANLSSIHMIGVSLGAHISGFTGANFNGEIGRITALDPAGPEFNGRPPEDRLDPSDALFVEALHTDMDALGYRNLLGHIDYYANGGADQPGCPKTILSGSEYFKCDHQRSVFLYMSSVNGSCPIIAYPCESYTDFQDGTCMDCGKFKSAGCPIFGYDSVRWRDTLVQLEQTRTYFQTNKASPFCKVGYKVDIVSWNQKTHWGYLTIKLSNGTEETQVELNHKSLKFERFQETSVLAQFERDIQPVKKITLKFCPRKGLRPRKKLRLLHIRLTPLQNHLRPLCRYDLLLEESKDVTFKPIPCEDSNF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
73	N-linked (GlcNAc...) asparagine			UniProt
137	N-linked (GlcNAc...) asparagine			UniProt
151	N-linked (GlcNAc...) asparagine			UniProt
267	N-linked (GlcNAc...) asparagine			UniProt
358	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Synthesis of PA	Danio rerio

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026