GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

UDP-glucuronic acid decarboxylase 1

Summary

UniProt ID: Q6DF08
Gene Symbol: uxs1
Gene ID: 448599
Organism: Xenopus tropicalis (tropical clawed frog)

External Links

Re-Glyco: Q6DF08

Annotation

Keyword: Decarboxylase Endoplasmic reticulum Glycoprotein Golgi apparatus NAD Reference proteome Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
glycosaminoglycan biosynthetic process	ISS	GO_REF
UDP-D-xylose biosynthetic process	IEA	GO_REF
D-xylose metabolic process	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide-sugar metabolic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

UDP-D-xylose metabolic process [inference]

UDP-D-xylose biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide-sugar metabolic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

UDP-D-xylose metabolic process [inference]

UDP-D-xylose biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

organophosphate biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

aminoglycan biosynthetic process [inference]

glycosaminoglycan biosynthetic process

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

organophosphate biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

carbohydrate derivative biosynthetic process [inference]

aminoglycan biosynthetic process [inference]

glycosaminoglycan biosynthetic process

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

macromolecule metabolic process [inference]

aminoglycan metabolic process [inference]

aminoglycan biosynthetic process [inference]

glycosaminoglycan biosynthetic process

glycosaminoglycan metabolic process [inference]

glycosaminoglycan biosynthetic process

macromolecule biosynthetic process [inference]

aminoglycan biosynthetic process [inference]

glycosaminoglycan biosynthetic process

primary metabolic process [inference]

carbohydrate metabolic process [inference]

monosaccharide metabolic process [inference]

pentose metabolic process [inference]

D-xylose metabolic process

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide-sugar metabolic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

UDP-D-xylose metabolic process [inference]

UDP-D-xylose biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

small molecule metabolic process [inference]

monosaccharide metabolic process [inference]

pentose metabolic process [inference]

D-xylose metabolic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide-sugar metabolic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

UDP-D-xylose metabolic process [inference]

UDP-D-xylose biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

carbohydrate derivative metabolic process [inference]

aminoglycan metabolic process [inference]

aminoglycan biosynthetic process [inference]

glycosaminoglycan biosynthetic process

glycosaminoglycan metabolic process [inference]

glycosaminoglycan biosynthetic process

nucleotide-sugar metabolic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

UDP-D-xylose metabolic process [inference]

UDP-D-xylose biosynthetic process

carbohydrate derivative biosynthetic process [inference]

aminoglycan biosynthetic process [inference]

glycosaminoglycan biosynthetic process

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

Displaying **all 5** entries
GO Term	Evidence Code	Reference
Golgi membrane	ISS	GO_REF
cytoplasm
endoplasmic reticulum membrane	ISS	GO_REF
endoplasmic reticulum membrane	IEA	GO_REF
Golgi cisterna membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

membrane [inference]

organelle membrane [inference]

bounding membrane of organelle [inference]

Golgi membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
UDP-glucuronate decarboxylase activity	ISS	GO_REF
UDP-glucuronate decarboxylase activity	IEA	GO_REF GO_REF GO_REF GO_REF
NAD+ binding	IBA	GO_REF
NAD+ binding	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

lyase activity [inference]

carbon-carbon lyase activity [inference]

carboxy-lyase activity [inference]

UDP-glucuronate decarboxylase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

NAD+ binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

NAD binding [inference]

NAD+ binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

NAD binding [inference]

NAD+ binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVRTRIQRLLTGINRRMMKLLIALALIAYVASVWGNFVNMSKSIQENGEQKMEKKIEEVIAPLREKIQNLERSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEEYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEQLTVYGSGEQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPQEHSIVQFARLIKQLVGSGGEISFLSEAQDDPQRRKPDIRKAKLLLGWEPVVPLEEGLNKTIHYFRKELEHQANNQYIPKPKPARVKKGRTRHN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
317	N-linked (GlcNAc...) asparagine			UniProt
386	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Formation of the active cofactor, UDP-glucuronate	Xenopus tropicalis
Glycosaminoglycan-protein linkage region biosynthesis	Xenopus tropicalis

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026