GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Rho-related GTP-binding protein RhoA-B

Summary

UniProt ID: Q6DHM9
Gene Symbol: rhoab zgc:153713
Gene ID: 100006041
Organism: Danio rerio (zebrafish)

External Links

PubChem: Q6DHM9
Re-Glyco: Q6DHM9

Annotation

Keyword: Cell membrane GTP-binding Glycoprotein Methylation Prenylation Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
actin filament organization	IBA	GO_REF
signal transduction
Rho protein signal transduction	IMP	PMID
Wnt signaling pathway	IGI	PMID
cell migration	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

microtubule-based process [inference]

microtubule cytoskeleton organization [inference]

establishment of spindle localization [inference]

establishment of mitotic spindle localization

microtubule cytoskeleton organization involved in mitosis [inference]

establishment of mitotic spindle localization

signal transduction

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction [inference]

Rho protein signal transduction

cell cycle process [inference]

spindle localization [inference]

establishment of spindle localization [inference]

establishment of mitotic spindle localization

mitotic cell cycle process [inference]

microtubule cytoskeleton organization involved in mitosis [inference]

establishment of mitotic spindle localization

cell motility [inference]

ameboidal-type cell migration [inference]

cell migration involved in gastrulation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization [inference]

microtubule cytoskeleton organization [inference]

establishment of spindle localization [inference]

establishment of mitotic spindle localization

microtubule cytoskeleton organization involved in mitosis [inference]

establishment of mitotic spindle localization

supramolecular fiber organization [inference]

actin filament organization

developmental process [inference]

anatomical structure morphogenesis [inference]

post-anal tail morphogenesis

anatomical structure development [inference]

otolith development

localization [inference]

establishment of localization [inference]

establishment of localization in cell [inference]

establishment of spindle localization [inference]

establishment of mitotic spindle localization

establishment of organelle localization [inference]

establishment of spindle localization [inference]

establishment of mitotic spindle localization

organelle localization [inference]

spindle localization [inference]

establishment of spindle localization [inference]

establishment of mitotic spindle localization

establishment of organelle localization [inference]

establishment of spindle localization [inference]

establishment of mitotic spindle localization

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of small GTPase mediated signal transduction [inference]

regulation of Rho protein signal transduction

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of small GTPase mediated signal transduction [inference]

regulation of Rho protein signal transduction

regulation of cellular process [inference]

signal transduction

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction [inference]

Rho protein signal transduction

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of small GTPase mediated signal transduction [inference]

regulation of Rho protein signal transduction

regulation of actin filament-based process [inference]

regulation of actin cytoskeleton organization

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

regulation of cytoskeleton organization [inference]

regulation of actin cytoskeleton organization

Displaying **all 2** entries
GO Term	Evidence Code	Reference
cytosol	IBA	GO_REF
plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytosol

membrane [inference]

plasma membrane

Displaying **all 3** entries
GO Term	Evidence Code	Reference
GTPase activity	IEA	GO_REF
GTP binding	IEA	GO_REF
protein kinase binding	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

ribonucleoside triphosphate phosphatase activity [inference]

GTPase activity

binding [inference]

protein binding [inference]

enzyme binding [inference]

kinase binding [inference]

protein kinase binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

GTP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELTKMKQEPVKAEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKSNKCCLL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
34	(Microbial infection) O-linked (GlcNAc) tyrosine; by Yersinia Afp18	26190758		UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026