GlyCosmos Portal

Submissions

GDP-fucose protein O-fucosyltransferase 1

Summary

UniProt ID: Q6EV69
Gene Symbol: FUT12 POFUT1
Gene ID: 449504
Organism: Pan troglodytes (chimpanzee)

External Links

Re-Glyco: Q6EV69

Annotation

Keyword: Disulfide bond Endoplasmic reticulum Fucose metabolism Glycoprotein Glycosyltransferase Manganese Notch signaling pathway Reference proteome Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
angiogenesis
somitogenesis
fucose metabolic process
Notch signaling pathway	IEA	GO_REF
nervous system development

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Notch signaling pathway

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via fucose

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via fucose

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via fucose

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via fucose

primary metabolic process [inference]

carbohydrate metabolic process [inference]

monosaccharide metabolic process [inference]

hexose metabolic process [inference]

fucose metabolic process

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via fucose

small molecule metabolic process [inference]

monosaccharide metabolic process [inference]

hexose metabolic process [inference]

fucose metabolic process

carbohydrate derivative metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via fucose

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via fucose

multicellular organismal process [inference]

pattern specification process [inference]

regionalization [inference]

anterior/posterior pattern specification [inference]

somitogenesis

segmentation [inference]

somitogenesis

developmental process [inference]

anatomical structure formation involved in morphogenesis [inference]

anatomical structure development [inference]

animal organ development [inference]

heart development

system development [inference]

nervous system development

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of Notch signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of Notch signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Notch signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of Notch signaling pathway

Displaying **all 5** entries
GO Term	Evidence Code	Reference
endoplasmic reticulum	ISS	GO_REF
endoplasmic reticulum	IBA	GO_REF
endoplasmic reticulum	IEA	GO_REF GO_REF
membrane	ISS	GO_REF
membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

Displaying **all 3** entries
GO Term	Evidence Code	Reference
peptide-O-fucosyltransferase activity	ISS	GO_REF
peptide-O-fucosyltransferase activity	IBA	GO_REF
peptide-O-fucosyltransferase activity	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

glycosyltransferase activity [inference]

hexosyltransferase activity [inference]

fucosyltransferase activity [inference]

peptide-O-fucosyltransferase activity

catalytic activity, acting on a protein [inference]

peptide-O-fucosyltransferase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRFSPKEHPVLALPGAPAQFPVLEEHRPLQKYMVWSDEMVKTGEAQIHAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAAPLTMTMCLPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHFIGNCVSSFTAFVKRERDLQGRPSSFFGMDRPPKLRDEF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
62	N-linked (GlcNAc...) asparagine			UniProt
160	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements