GlyCosmos Portal

Submissions

Metalloproteinase inhibitor 1

Summary

UniProt ID: Q6FGX5
Gene Symbol: CLGI TIMP TIMP1 hCG_29141
Gene ID: 7076
Organism: Homo sapiens (human)

External Links

GlycoProtDB: GPDB0012209
Re-Glyco: Q6FGX5

Annotation

Keyword: Collagen Disulfide bond Glycoprotein Growth factor Metal-binding Metalloprotease inhibitor Phosphoprotein Secreted Signal Zinc

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
connective tissue replacement involved in inflammatory response wound healing
response to cytokine	IEA	GO_REF
negative regulation of apoptotic process	IEA	GO_REF
response to peptide hormone	IEA	GO_REF
negative regulation of proteolysis	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to peptide

cellular response to oxygen-containing compound [inference]

cellular response to aldehyde [inference]

cellular response to acetaldehyde

multicellular organismal process [inference]

tissue remodeling [inference]

connective tissue replacement [inference]

connective tissue replacement involved in inflammatory response wound healing

developmental process [inference]

anatomical structure development [inference]

animal organ development [inference]

cartilage development

response to stimulus [inference]

response to endogenous stimulus [inference]

response to hormone [inference]

response to peptide hormone

response to chemical [inference]

response to hormone [inference]

response to peptide hormone

cellular response to chemical stimulus [inference]

cellular response to peptide

cellular response to oxygen-containing compound [inference]

cellular response to aldehyde [inference]

cellular response to acetaldehyde

response to peptide [inference]

response to nitrogen compound [inference]

response to peptide hormone

response to oxygen-containing compound [inference]

response to peptide hormone

cellular response to oxygen-containing compound [inference]

cellular response to aldehyde [inference]

cellular response to acetaldehyde

response to acetaldehyde [inference]

cellular response to acetaldehyde

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to peptide

cellular response to oxygen-containing compound [inference]

cellular response to aldehyde [inference]

cellular response to acetaldehyde

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of proteolysis

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

regulation of cellular process [inference]

regulation of metabolic process [inference]

negative regulation of metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of proteolysis

regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of proteolysis

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

negative regulation of proteolysis

negative regulation of protein metabolic process [inference]

negative regulation of proteolysis

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

negative regulation of proteolysis

negative regulation of protein metabolic process [inference]

negative regulation of proteolysis

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of proteolysis

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

Displaying **all 4** entries
GO Term	Evidence Code	Reference
extracellular region	IEA	GO_REF GO_REF
collagen trimer
basement membrane	IEA	GO_REF
secretory granule lumen	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

collagen trimer

cellular anatomical structure [inference]

extracellular region

external encapsulating structure [inference]

extracellular matrix [inference]

basement membrane

membrane-enclosed lumen [inference]

organelle lumen [inference]

vesicle lumen [inference]

cytoplasmic vesicle lumen [inference]

secretory granule lumen

intracellular organelle lumen [inference]

cytoplasmic vesicle lumen [inference]

secretory granule lumen

Displaying **all 4** entries
GO Term	Evidence Code	Reference
protease binding	IEA	GO_REF
growth factor activity
metalloendopeptidase inhibitor activity	IEA	GO_REF
metal ion binding

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

enzyme binding [inference]

protease binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

peptidase regulator activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

endopeptidase regulator activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

growth factor activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

growth factor activity

molecular function inhibitor activity [inference]

enzyme inhibitor activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites