GlyCosmos Portal

Submissions

GDNF family receptor alpha-like

Summary

UniProt ID: Q6UXV0
Gene Symbol: GFRAL C6orf144 UNQ9356/PRO34128
Gene ID: 389400
Organism: Homo sapiens (human)

External Links

Re-Glyco: Q6UXV0

Annotation

Keyword: 3D-structure Cell membrane Disulfide bond Glycoprotein Hormone Receptor Reference proteome Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
reduction of food intake in response to dietary excess	ISS	GO_REF
reduction of food intake in response to dietary excess	IEA	GO_REF
nervous system development	IBA	GO_REF
stress-activated protein kinase signaling cascade
negative regulation of appetite	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

glial cell-derived neurotrophic factor receptor signaling pathway [inference]

GDF15-GFRAL signaling pathway

intracellular signal transduction [inference]

stress-activated protein kinase signaling cascade

cellular response to stimulus [inference]

cellular response to stress [inference]

multicellular organismal process [inference]

behavior [inference]

feeding behavior [inference]

eating behavior [inference]

reduction of food intake in response to dietary excess

developmental process [inference]

anatomical structure development [inference]

system development [inference]

nervous system development

response to stimulus [inference]

response to stress [inference]

cellular response to stress [inference]

response to chemical [inference]

response to nitrogen compound [inference]

response to metformin

cellular response to stimulus [inference]

cellular response to stress [inference]

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of response to nutrient levels [inference]

negative regulation of response to food [inference]

negative regulation of appetite

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of response to nutrient levels [inference]

regulation of response to food [inference]

negative regulation of response to food [inference]

negative regulation of appetite

negative regulation of response to nutrient levels [inference]

negative regulation of response to food [inference]

negative regulation of appetite

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of response to nutrient levels [inference]

negative regulation of response to food [inference]

negative regulation of appetite

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

glial cell-derived neurotrophic factor receptor signaling pathway [inference]

GDF15-GFRAL signaling pathway

intracellular signal transduction [inference]

stress-activated protein kinase signaling cascade

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of neuron apoptotic process [inference]

negative regulation of neuron apoptotic process

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of biological quality [inference]

regulation of appetite [inference]

negative regulation of appetite

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
nucleoplasm
plasma membrane	IDA	PMID GO_REF
plasma membrane	IEA	GO_REF GO_REF
focal adhesion
external side of plasma membrane	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex

cellular anatomical structure [inference]

nucleoplasm

membrane [inference]

plasma membrane

cell junction [inference]

anchoring junction [inference]

cell-substrate junction [inference]

focal adhesion

organelle [inference]

membraneless organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton [inference]

actin cytoskeleton

intracellular organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton [inference]

actin cytoskeleton

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
hormone activity
glial cell-derived neurotrophic factor receptor activity	IDA	PMID PMID PMID PMID PMID
glial cell-derived neurotrophic factor receptor activity	IEA	GO_REF GO_REF
receptor tyrosine kinase binding	IPI	PMID PMID PMID
receptor tyrosine kinase binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

receptor tyrosine kinase binding

enzyme binding [inference]

kinase binding [inference]

protein kinase binding [inference]

protein tyrosine kinase binding [inference]

receptor tyrosine kinase binding

molecular transducer activity [inference]

signaling receptor activity

transmembrane signaling receptor activity [inference]

cytokine receptor activity [inference]

glial cell-derived neurotrophic factor receptor activity

immune receptor activity [inference]

cytokine receptor activity [inference]

glial cell-derived neurotrophic factor receptor activity

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

hormone activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

hormone activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MIVFIFLAMGLSLENEYTSQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGEVIYAAMCMTVTCGILLLVMVKLRTSRISSKARDPSSIQIPGEL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	Source
23	N-linked (GlcNAc...) asparagine	UniProt
50	N-linked (GlcNAc...) asparagine	UniProt
62	N-linked (GlcNAc...) asparagine	UniProt
67	N-linked (GlcNAc...) asparagine	UniProt
103	N-linked (GlcNAc...) asparagine	UniProt
116	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements