GlyCosmos Portal

Submissions

UDP-glucuronosyltransferase 1A7

Summary

UniProt ID: Q6ZQM8
Gene Symbol: Ugt1a7 Ugt1a7c
Gene ID: 394432
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0005914
PubChem: Q6ZQM8
Re-Glyco: Q6ZQM8

Annotation

Keyword: Alternative splicing Endoplasmic reticulum Glycoprotein Glycosyltransferase Lipid metabolism Reference proteome Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
liver development	IBA	GO_REF
estrogen catabolic process	ISO	GO_REF
estrogen metabolic process	ISS	GO_REF
estrogen metabolic process	IBA	GO_REF
coumarin catabolic process	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

lipid catabolic process [inference]

steroid catabolic process [inference]

estrogen catabolic process

hormone catabolic process [inference]

estrogen catabolic process

phenylpropanoid catabolic process [inference]

coumarin catabolic process

secondary metabolic process [inference]

phenylpropanoid metabolic process [inference]

coumarin metabolic process [inference]

coumarin catabolic process

phenylpropanoid catabolic process [inference]

coumarin catabolic process

hormone metabolic process [inference]

estrogen metabolic process

estrogen catabolic process

hormone catabolic process [inference]

estrogen catabolic process

primary metabolic process [inference]

lipid metabolic process [inference]

steroid metabolic process [inference]

steroid catabolic process [inference]

estrogen catabolic process

estrogen metabolic process

estrogen catabolic process

lipid catabolic process [inference]

steroid catabolic process [inference]

estrogen catabolic process

developmental process [inference]

anatomical structure development [inference]

animal organ development [inference]

gland development [inference]

liver development

biological regulation [inference]

regulation of biological quality [inference]

regulation of hormone levels [inference]

hormone metabolic process [inference]

estrogen metabolic process

estrogen catabolic process

hormone catabolic process [inference]

estrogen catabolic process

Displaying **all 5** entries
GO Term	Evidence Code	Reference
endoplasmic reticulum	ISO	GO_REF
endoplasmic reticulum	IBA	GO_REF
endoplasmic reticulum membrane	ISS	GO_REF
endoplasmic reticulum membrane	ISO	GO_REF
endoplasmic reticulum membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

endoplasmic reticulum membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
retinoic acid binding	ISO	GO_REF
enzyme inhibitor activity	ISO	GO_REF
enzyme inhibitor activity	IBA	GO_REF
protein kinase C binding	ISO	GO_REF
steroid binding	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

glycosyltransferase activity [inference]

UDP-glycosyltransferase activity [inference]

glucuronosyltransferase activity

hexosyltransferase activity [inference]

glucuronosyltransferase activity

binding [inference]

protein binding [inference]

enzyme binding

kinase binding [inference]

protein kinase binding [inference]

protein kinase C binding

identical protein binding

protein homodimerization activity

protein dimerization activity [inference]

lipid binding [inference]

isoprenoid binding [inference]

retinoid binding [inference]

retinoic acid binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

carboxylic acid binding [inference]

monocarboxylic acid binding [inference]

organic acid binding [inference]

carboxylic acid binding [inference]

monocarboxylic acid binding [inference]

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity

molecular function inhibitor activity [inference]

enzyme inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAPADFPASLPLCVCLLLASGLAQAGRLLVVPMDGSHWFTMQTVVEKLLHKGHEVVVVVPEVSWQLTKPLNFVVKTYAVSHTQEDLNREFKIFIDAQWKSQQEGGILPLLDSPAKGFFELLFSHCRSLFNDKKLVEYLKQTSFDAVFLDPFDVCGLTVAKYFSLPSVVFSRGIFCHYLEDAAQCPSPPSYIPRMLLKFTDTMTFKERTRNLLAYMGERAFCHKFFKSAADIASEVLQTPVTMTDLFSPVSIWLLRTDFVLEFPRPVMPNVIYIGGINCHQGKPLSKEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKCFGGKGRVKKSHKSKTH

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
293	N-linked (GlcNAc...) asparagine			UniProt
431	N-linked (GlcNAc...) asparagine			GlycoProtDB UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
APAP ADME	Mus musculus
Aspirin ADME	Mus musculus
Glucuronidation	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements