GlyCosmos Portal

Submissions

Lysosomal Pro-X carboxypeptidase

Summary

UniProt ID: Q7TMR0
Gene Symbol: Prcp
Gene ID: 72461
Organism: Mus musculus (house mouse)

External Links

PubChem: Q7TMR0
Re-Glyco: Q7TMR0

Annotation

Keyword: Alternative splicing Carboxypeptidase Disulfide bond Glycoprotein Lysosome Reference proteome Signal Zymogen

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
angiotensin maturation	IMP	PMID
regulation of thyroid hormone receptor signaling pathway	IMP	PMID
plasma kallikrein-kinin cascade	IMP	PMID
negative regulation of systemic arterial blood pressure	IMP	PMID
negative regulation of systemic arterial blood pressure	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

hormone metabolic process [inference]

peptide hormone processing [inference]

angiotensin maturation

macromolecule metabolic process [inference]

protein metabolic process [inference]

proteolysis [inference]

protein processing [inference]

signaling receptor ligand precursor processing [inference]

peptide hormone processing [inference]

angiotensin maturation

protein maturation [inference]

protein processing [inference]

signaling receptor ligand precursor processing [inference]

peptide hormone processing [inference]

angiotensin maturation

protein activation cascade [inference]

kinin cascade [inference]

plasma kallikrein-kinin cascade

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis [inference]

protein processing [inference]

signaling receptor ligand precursor processing [inference]

peptide hormone processing [inference]

angiotensin maturation

protein maturation [inference]

protein processing [inference]

signaling receptor ligand precursor processing [inference]

peptide hormone processing [inference]

angiotensin maturation

protein activation cascade [inference]

kinin cascade [inference]

plasma kallikrein-kinin cascade

multicellular organismal process [inference]

multicellular organismal-level homeostasis [inference]

energy homeostasis

developmental process [inference]

anatomical structure formation involved in morphogenesis [inference]

angiogenesis [inference]

angiogenesis involved in wound healing

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

energy homeostasis

chemical homeostasis [inference]

carbohydrate homeostasis [inference]

glucose homeostasis

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response [inference]

acute inflammatory response [inference]

kinin cascade [inference]

plasma kallikrein-kinin cascade

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of thyroid hormone receptor signaling pathway

regulation of locomotion [inference]

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

regulation of blood vessel endothelial cell migration

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of thyroid hormone receptor signaling pathway

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of thyroid hormone receptor signaling pathway

regulation of metabolic process [inference]

regulation of reactive oxygen species metabolic process

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

regulation of blood vessel endothelial cell migration

regulation of biological quality [inference]

regulation of blood pressure [inference]

negative regulation of blood pressure [inference]

negative regulation of systemic arterial blood pressure

regulation of hormone levels [inference]

hormone metabolic process [inference]

peptide hormone processing [inference]

angiotensin maturation

Displaying **all 5** entries
GO Term	Evidence Code	Reference
extracellular region	IDA	PMID
lysosome	IDA	PMID
lysosome	IBA	GO_REF
lysosome	IEA	GO_REF
basal part of cell	IDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

basal part of cell

Displaying **all 3** entries
GO Term	Evidence Code	Reference
metallocarboxypeptidase activity	IMP	PMID
serine-type carboxypeptidase activity	IEA	GO_REF
dipeptidyl-peptidase activity

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

serine-type peptidase activity [inference]

serine-type exopeptidase activity [inference]

serine-type carboxypeptidase activity

metallopeptidase activity [inference]

metalloexopeptidase activity [inference]

metallocarboxypeptidase activity

exopeptidase activity [inference]

carboxypeptidase activity [inference]

metalloexopeptidase activity [inference]

metallocarboxypeptidase activity

dipeptidyl-peptidase activity

serine-type exopeptidase activity [inference]

serine-type carboxypeptidase activity

serine hydrolase activity [inference]

serine-type peptidase activity [inference]

serine-type exopeptidase activity [inference]

serine-type carboxypeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

serine-type peptidase activity [inference]

serine-type exopeptidase activity [inference]

serine-type carboxypeptidase activity

metallopeptidase activity [inference]

metalloexopeptidase activity [inference]

metallocarboxypeptidase activity

exopeptidase activity [inference]

carboxypeptidase activity [inference]

metalloexopeptidase activity [inference]

metallocarboxypeptidase activity

dipeptidyl-peptidase activity

serine-type exopeptidase activity [inference]

serine-type carboxypeptidase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGCRALLLLSFLLLGAATTIPPRLKTLGSPHLSASPTPDPAVARKYSVLYFEQKVDHFGFADMRTFKQRYLVADKHWQRNGGSILFYTGNEGDIVWFCNNTGFMWDVAEELKAMLVFAEHRYYGESLPFGQDSFKDSQHLNFLTSEQALADFAELIRHLEKTIPGAQGQPVIAIGGSYGGMLAAWFRMKYPHIVVGALAASAPIWQLDGMVPCGEFMKIVTNDFRKSGPYCSESIRKSWNVIDKLSGSGSGLQSLTNILHLCSPLTSEKIPTLKGWIAETWVNLAMVNYPYACNFLQPLPAWPIKEVCQYLKNPNVSDTVLLQNIFQALSVYYNYSGQAACLNISQTTTSSLGSMGWSFQACTEMVMPFCTNGIDDMFEPFLWDLEKYSNDCFNQWGVKPRPHWMTTMYGGKNISSHSNIIFSNGELDPWSGGGVTRDITDTLVAINIHDGAHHLDLRAHNAFDPSSVLLSRLLEVKHMKKWILDFYSNIQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	Source
99	N-linked (GlcNAc...) asparagine	UniProt
315	N-linked (GlcNAc...) asparagine	UniProt
334	N-linked (GlcNAc...) asparagine	UniProt
343	N-linked (GlcNAc...) asparagine	UniProt
413	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
FXIIa activates plasma kallikrein-kinin system	Mus musculus
Neutrophil degranulation	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements