GlyCosmos Portal

Submissions

Hedgehog-interacting protein

Summary

UniProt ID: Q7TN16
Gene Symbol: Hhip Hip
Gene ID: 15245
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0005969
PubChem: Q7TN16
Re-Glyco: Q7TN16

Annotation

Keyword: Cell membrane Disulfide bond EGF-like domain Glycoprotein Metal-binding Reference proteome Repeat Secreted Signal Zinc

Gene Ontology (GO)

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
signal transduction	IDA	PMID
neuroblast proliferation	IGI	PMID
animal organ morphogenesis	IMP	PMID
dorsal/ventral pattern formation	IGI	PMID
negative regulation of signal transduction	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction

cell population proliferation [inference]

neural precursor cell proliferation [inference]

neuroblast proliferation

multicellular organismal process [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

epithelial tube branching involved in lung morphogenesis

pattern specification process [inference]

regionalization [inference]

dorsal/ventral pattern formation

developmental process [inference]

anatomical structure morphogenesis [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

epithelial tube branching involved in lung morphogenesis

animal organ morphogenesis

skeletal system morphogenesis

tube morphogenesis [inference]

branching morphogenesis of an epithelial tube [inference]

epithelial tube branching involved in lung morphogenesis

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

epithelial tube branching involved in lung morphogenesis

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of smoothened signaling pathway [inference]

negative regulation of smoothened signaling pathway

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

regulation of fibroblast growth factor receptor signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of response to stimulus [inference]

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of smoothened signaling pathway [inference]

negative regulation of smoothened signaling pathway

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

regulation of fibroblast growth factor receptor signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

regulation of cellular response to growth factor stimulus [inference]

regulation of fibroblast growth factor receptor signaling pathway

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of cellular process [inference]

signal transduction

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of smoothened signaling pathway [inference]

negative regulation of smoothened signaling pathway

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

regulation of fibroblast growth factor receptor signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction

negative regulation of smoothened signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

Displaying **all 4** entries
GO Term	Evidence Code	Reference
extracellular region	IEA	GO_REF
plasma membrane	IDA	PMID
plasma membrane	IEA	GO_REF GO_REF
cell surface	IDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

Displaying **all 5** entries
GO Term	Evidence Code	Reference
zinc ion binding	ISS	GO_REF
zinc ion binding	ISO	GO_REF
zinc ion binding	IEA	GO_REF
hedgehog family protein binding	ISO	GO_REF
hedgehog family protein binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

hedgehog family protein binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRVMSQLELLSGGEILCGGFYPRVSCCLQSDSPGLGRLENKIFSATNNSECSRLLEEIQCAPCSPHSQSLFYTPERDVLDGDLALPLLCKDYCKEFFYTCRGHIPGLLQTTADEFCFYYARKDAGLCFPDFPRKQVRGPASNYLGQMEDYEKVGGISRKHKHNCLCVQEVMSGLRQPVSAVHSGDGSHRLFILEKEGYVKILTPEGELFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDVRTARVFLEVAELHRKHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGRDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGASSSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRVTVQPAQPLTSDCSRLCRNGYYTPTGKCCCSPGWEGDFCRIAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDRNVRRVTRAGILDQIIDMTSYLLDLTSYIV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	Source
99	N-linked (GlcNAc...) asparagine	GlycoProtDB UniProt
416	N-linked (GlcNAc...) asparagine	UniProt
447	N-linked (GlcNAc...) asparagine	UniProt
459	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Ligand-receptor interactions	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements