GlyCosmos Portal

Submissions

Tumor necrosis factor receptor superfamily member 14

Summary

UniProt ID: Q80WM9
Gene Symbol: Tnfrsf14 hvem
Gene ID: 230979
Organism: Mus musculus (house mouse)

External Links

PubChem: Q80WM9
Re-Glyco: Q80WM9

Annotation

Keyword: 3D-structure Adaptive immunity Cell membrane Disulfide bond Glycoprotein Host cell receptor for virus entry Host-virus interaction Innate immunity Phosphoprotein Reference proteome Repeat Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
adaptive immune response
positive regulation of cytokine production involved in immune response	IMP	PMID
positive regulation of cytokine production involved in immune response	IBA	GO_REF
T cell costimulation	ISO	GO_REF
negative regulation of T cell proliferation	ISO	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

lymphocyte costimulation [inference]

T cell costimulation

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to bacterium [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

immune response [inference]

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune memory response

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of T cell migration

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

lymphocyte costimulation [inference]

T cell costimulation

positive regulation of T cell activation [inference]

T cell costimulation

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of T cell migration

regulation of mononuclear cell migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of T cell migration

regulation of lymphocyte migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of T cell migration

regulation of T cell migration [inference]

positive regulation of T cell migration

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

lymphocyte costimulation [inference]

T cell costimulation

positive regulation of T cell activation [inference]

T cell costimulation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

positive regulation of T cell activation [inference]

T cell costimulation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

positive regulation of lymphocyte activation [inference]

lymphocyte costimulation [inference]

T cell costimulation

positive regulation of T cell activation [inference]

T cell costimulation

regulation of immune effector process [inference]

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response

regulation of production of molecular mediator of immune response [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response

regulation of cytokine production involved in immune response [inference]

positive regulation of cytokine production involved in immune response

regulation of immune response [inference]

regulation of adaptive immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune memory response

regulation of adaptive immune memory response [inference]

negative regulation of adaptive immune memory response

negative regulation of immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune memory response

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of T cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of T cell migration

regulation of mononuclear cell migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of T cell migration

regulation of lymphocyte migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of T cell migration

regulation of T cell migration [inference]

positive regulation of T cell migration

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of T cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of T cell migration

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of T cell migration

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

lymphocyte costimulation [inference]

T cell costimulation

positive regulation of T cell activation [inference]

T cell costimulation

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of T cell migration

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

T cell costimulation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

lymphocyte costimulation [inference]

T cell costimulation

positive regulation of T cell activation [inference]

T cell costimulation

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of T cell migration

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

lymphocyte costimulation [inference]

T cell costimulation

positive regulation of T cell activation [inference]

T cell costimulation

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune memory response

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of response to stimulus [inference]

negative regulation of immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune memory response

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of response to stimulus [inference]

negative regulation of response to stimulus [inference]

negative regulation of immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune memory response

regulation of immune response [inference]

regulation of adaptive immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune memory response

regulation of adaptive immune memory response [inference]

negative regulation of adaptive immune memory response

negative regulation of immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune memory response

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response

regulation of cytokine production involved in immune response [inference]

positive regulation of cytokine production involved in immune response

regulation of production of molecular mediator of immune response [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response

regulation of cytokine production involved in immune response [inference]

positive regulation of cytokine production involved in immune response

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response

regulation of cytokine production involved in immune response [inference]

positive regulation of cytokine production involved in immune response

regulation of production of molecular mediator of immune response [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response

regulation of cytokine production involved in immune response [inference]

positive regulation of cytokine production involved in immune response

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of cell-cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

T cell costimulation

regulation of leukocyte cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

T cell costimulation

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

T cell costimulation

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

T cell costimulation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

lymphocyte costimulation [inference]

T cell costimulation

positive regulation of T cell activation [inference]

T cell costimulation

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of T cell migration

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

lymphocyte costimulation [inference]

T cell costimulation

positive regulation of T cell activation [inference]

T cell costimulation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

positive regulation of T cell activation [inference]

T cell costimulation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

positive regulation of lymphocyte activation [inference]

lymphocyte costimulation [inference]

T cell costimulation

positive regulation of T cell activation [inference]

T cell costimulation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

lymphocyte costimulation [inference]

T cell costimulation

positive regulation of T cell activation [inference]

T cell costimulation

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of T cell migration

regulation of mononuclear cell migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of T cell migration

regulation of lymphocyte migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of T cell migration

regulation of T cell migration [inference]

positive regulation of T cell migration

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of T cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of T cell migration

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response

regulation of cytokine production involved in immune response [inference]

positive regulation of cytokine production involved in immune response

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

lymphocyte costimulation [inference]

T cell costimulation

positive regulation of T cell activation [inference]

T cell costimulation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

positive regulation of T cell activation [inference]

T cell costimulation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

positive regulation of lymphocyte activation [inference]

lymphocyte costimulation [inference]

T cell costimulation

positive regulation of T cell activation [inference]

T cell costimulation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

lymphocyte costimulation [inference]

T cell costimulation

positive regulation of T cell activation [inference]

T cell costimulation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

lymphocyte costimulation [inference]

T cell costimulation

positive regulation of T cell activation [inference]

T cell costimulation

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	ISO	GO_REF
plasma membrane	EXP	PMID
plasma membrane	TAS	Reactome
plasma membrane	IEA	GO_REF GO_REF
external side of plasma membrane	IDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

side of membrane [inference]

external side of plasma membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
virus receptor activity
cytokine binding	ISO	GO_REF
ubiquitin protein ligase binding	ISO	GO_REF
receptor ligand activity	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

enzyme binding [inference]

ubiquitin-like protein ligase binding [inference]

ubiquitin protein ligase binding

cytokine binding

exogenous protein binding [inference]

virus receptor activity

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEPLPGWGSAPWSQAPTDNTFRLVPCVFLLNLLQRISAQPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQVVYYVVSILLPLVIVGAGIAGFLICTRRHLHTSSVAKELEPFQEQQENTIRFPVTEVGFAETEEETASN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
184	N-linked (GlcNAc...) asparagine			UniProt
197	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Co-inhibition by BTLA	Mus musculus
TNFs bind their physiological receptors	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements