GlyCosmos Portal

Submissions

Interleukin-22 receptor subunit alpha-1

Summary

UniProt ID: Q80XZ4
Gene Symbol: Il22ra1
Gene ID: 230828
Organism: Mus musculus (house mouse)

External Links

PubChem: Q80XZ4
Re-Glyco: Q80XZ4

Annotation

Keyword: 3D-structure Cell membrane Disulfide bond Glycoprotein Isopeptide bond Phosphoprotein Receptor Reference proteome Repeat Signal Transmembrane helix Ubl conjugation

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
cytokine-mediated signaling pathway	IBA	GO_REF
negative regulation of inflammatory response	IDA	PMID
defense response to Gram-negative bacterium	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to Gram-negative bacterium

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to bacterium [inference]

defense response to Gram-negative bacterium

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to Gram-negative bacterium

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to Gram-negative bacterium

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of response to stimulus [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

regulation of inflammatory response [inference]

negative regulation of inflammatory response

negative regulation of response to stimulus [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

regulation of response to stress [inference]

regulation of defense response [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response

regulation of inflammatory response [inference]

negative regulation of inflammatory response

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway

Displaying **all 3** entries
GO Term	Evidence Code	Reference
plasma membrane	ISS	PMID
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
cytokine receptor activity	IBA	GO_REF
cytokine receptor activity	IEA	GO_REF
interleukin-20 binding	IPI	PMID
interleukin-22 receptor activity	IDA	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

cytokine binding [inference]

interleukin-20 binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

cytokine receptor activity

interleukin-22 receptor activity

immune receptor activity [inference]

cytokine receptor activity

interleukin-22 receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKTLLTILTVGSLAAHTTVDTSGLLQHVKFQSSNFENILTWDGGPASTSDTVYSVEYKKYGERKWLAKAGCQRITQKFCNLTMETRNHTEFYYAKVTAVSAGGPPVTKMTDRFSSLQHTTIKPPDVTCIPKVRSIQMLVHPTLTPVLSEDGHQLTLEEIFHDLFYRLELHVNHTYQMHLEGKQREYEFLGLTPDTEFLGSITILTPILSKESAPYVCRVKTLPDRTWAYSFSGAVLFSMGFLVGLLCYLGYKYITKPPVPPNSLNVQRVLTFQPLRFIQEHVLIPVLDLSGPSSLPQPIQYSQVVVSGPREPPGAVWRQSLSDLTYVGQSDVSILQPTNVPAQQTLSPPSYAPKAVPEVQPPSYAPQVASDAKALFYSPQQGMKTRPATYDPQDILDSCPASYAVCVEDSGKDSTPGILSTPKYLKTKGQLQEDTLVRSCLPGDLSLQKVTSLGEGETQRPKSLPSPLGFCTDRGPDLHTLRSEEPETPRYLKGALSLLSSVQIEGHPVSLPLHVHSVSCSPSDEGPSPWGLLDSLVCPKDEGPAVETEAMCPSAAASELEQSTELDSLFKGLALTVQWES

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
80	N-linked (GlcNAc...) asparagine			UniProt
172	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Interleukin-20 family signaling	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements