GlyCosmos Portal

Submissions

R-spondin-2

Summary

UniProt ID: Q8BFU0
Gene Symbol: Rspo2
Gene ID: 239405
Organism: Mus musculus (house mouse)

External Links

Re-Glyco: Q8BFU0

Annotation

Keyword: 3D-structure Developmental protein Disulfide bond Glycoprotein Heparin-binding Reference proteome Secreted Sensory transduction Signal Wnt signaling pathway

Gene Ontology (GO)

Displaying entries **1 - 5** of 20 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
osteoblast differentiation	IGI	PMID
Wnt signaling pathway
positive regulation of Wnt signaling pathway	ISO	GO_REF
positive regulation of Wnt signaling pathway	IEA	GO_REF GO_REF
bone mineralization	IGI	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

cellular developmental process [inference]

cell differentiation [inference]

osteoblast differentiation

neuron differentiation [inference]

dopaminergic neuron differentiation

multicellular organismal process [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

epithelial tube branching involved in lung morphogenesis

organ growth [inference]

lung growth

developmental process [inference]

anatomical structure morphogenesis [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

epithelial tube branching involved in lung morphogenesis

animal organ morphogenesis [inference]

cartilage morphogenesis [inference]

trachea cartilage morphogenesis

appendage morphogenesis [inference]

limb morphogenesis [inference]

embryonic limb morphogenesis [inference]

forelimb morphogenesis [inference]

embryonic forelimb morphogenesis

hindlimb morphogenesis [inference]

embryonic hindlimb morphogenesis

embryonic appendage morphogenesis [inference]

embryonic limb morphogenesis [inference]

tube morphogenesis [inference]

branching morphogenesis of an epithelial tube [inference]

epithelial tube branching involved in lung morphogenesis

embryonic morphogenesis [inference]

embryonic appendage morphogenesis [inference]

embryonic limb morphogenesis [inference]

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

epithelial tube branching involved in lung morphogenesis

cartilage morphogenesis [inference]

trachea cartilage morphogenesis

anatomical structure development [inference]

tissue development [inference]

biomineral tissue development [inference]

bone mineralization

appendage development [inference]

limb development

cellular developmental process [inference]

cell differentiation [inference]

osteoblast differentiation

neuron differentiation [inference]

dopaminergic neuron differentiation

growth [inference]

developmental growth [inference]

organ growth [inference]

lung growth

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

positive regulation of canonical Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway

positive regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

positive regulation of canonical Wnt signaling pathway

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

positive regulation of canonical Wnt signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

positive regulation of canonical Wnt signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

positive regulation of canonical Wnt signaling pathway

negative regulation of biological process [inference]

negative regulation of developmental process [inference]

negative regulation of animal organ morphogenesis [inference]

negative regulation of odontogenesis [inference]

negative regulation of odontogenesis of dentin-containing tooth

negative regulation of multicellular organismal process [inference]

negative regulation of animal organ morphogenesis [inference]

negative regulation of odontogenesis [inference]

negative regulation of odontogenesis of dentin-containing tooth

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

positive regulation of canonical Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway

positive regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

positive regulation of canonical Wnt signaling pathway

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of animal organ morphogenesis [inference]

regulation of odontogenesis [inference]

negative regulation of odontogenesis [inference]

negative regulation of odontogenesis of dentin-containing tooth

regulation of odontogenesis of dentin-containing tooth [inference]

negative regulation of odontogenesis of dentin-containing tooth

negative regulation of animal organ morphogenesis [inference]

negative regulation of odontogenesis [inference]

negative regulation of odontogenesis of dentin-containing tooth

negative regulation of developmental process [inference]

negative regulation of animal organ morphogenesis [inference]

negative regulation of odontogenesis [inference]

negative regulation of odontogenesis of dentin-containing tooth

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

positive regulation of canonical Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway

positive regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

positive regulation of canonical Wnt signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway

positive regulation of canonical Wnt signaling pathway

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of animal organ morphogenesis [inference]

negative regulation of odontogenesis [inference]

negative regulation of odontogenesis of dentin-containing tooth

Displaying **all 4** entries
GO Term	Evidence Code	Reference
extracellular region	IDA	PMID PMID
extracellular region	IEA	GO_REF
obsolete extracellular space
cell surface	IDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

Displaying **all 4** entries
GO Term	Evidence Code	Reference
signaling receptor binding	ISO	GO_REF
signaling receptor binding	IEA	GO_REF
heparin binding	IDA	PMID PMID
BMP receptor binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding

receptor serine/threonine kinase binding [inference]

transmembrane receptor protein serine/threonine kinase binding [inference]

BMP receptor binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

heparin binding

sulfur compound binding [inference]

heparin binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MRFCLFSFALIILNCMDYSQCQGNRWRRNKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLDETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPAKDTIPCPTIAESRRCKMAMRHCPGGKRTPKAKEKRNKKKRRKLIERAQEQHSVFLATDRVNQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites