GlyCosmos Portal

Submissions

D(1B) dopamine receptor

Summary

UniProt ID

Q8BLD9

Gene Symbol

Drd5

Gene ID

[13492]

Organism

Mus musculus (house mouse)

External Links

PubChem: Q8BLD9
Re-Glyco: Q8BLD9

Annotation

Keyword: Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Palmitate Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 34 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
response to amphetamine	IGI	PMID
response to amphetamine	IEA	GO_REF
regulation of systemic arterial blood pressure by vasopressin	IGI	PMID
norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure	IMP	PMID
adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISO	GO_REF GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-modulating G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-activating G protein-coupled receptor signaling pathway

G protein-coupled dopamine receptor signaling pathway

adenylate cyclase-activating dopamine receptor signaling pathway

adrenergic receptor signaling pathway [inference]

adenylate cyclase-activating adrenergic receptor signaling pathway

metabolic process [inference]

reactive oxygen species metabolic process

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to monoamine stimulus [inference]

cellular response to catecholamine stimulus

cellular response to oxygen-containing compound [inference]

cellular response to catecholamine stimulus

reproductive process [inference]

multicellular organismal reproductive process [inference]

reproductive behavior [inference]

mating behavior

female mating behavior [inference]

regulation of female receptivity

multicellular organismal process [inference]

system process [inference]

circulatory system process [inference]

vascular process in circulatory system [inference]

blood vessel diameter maintenance [inference]

vasoconstriction [inference]

norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure

nervous system process [inference]

transmission of nerve impulse

cognition [inference]

learning or memory [inference]

learning [inference]

associative learning

visual learning

nonassociative learning [inference]

sensitization

endocrine process [inference]

regulation of systemic arterial blood pressure by hormone [inference]

regulation of systemic arterial blood pressure by vasopressin

behavior [inference]

learning or memory [inference]

learning [inference]

associative learning

visual learning

nonassociative learning [inference]

sensitization

visual behavior [inference]

visual learning

reproductive behavior [inference]

mating behavior

female mating behavior [inference]

regulation of female receptivity

response to stimulus [inference]

response to stress [inference]

response to wounding [inference]

wound healing

response to abiotic stimulus [inference]

response to radiation [inference]

response to light stimulus [inference]

visual behavior [inference]

visual learning

response to chemical [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to monoamine stimulus [inference]

cellular response to catecholamine stimulus

cellular response to oxygen-containing compound [inference]

cellular response to catecholamine stimulus

response to nitrogen compound [inference]

response to amine [inference]

response to amphetamine

response to alkaloid [inference]

response to cocaine

response to monoamine [inference]

cellular response to monoamine stimulus [inference]

cellular response to catecholamine stimulus

response to catecholamine [inference]

cellular response to catecholamine stimulus

cellular response to nitrogen compound [inference]

cellular response to monoamine stimulus [inference]

cellular response to catecholamine stimulus

response to oxygen-containing compound [inference]

response to cocaine

response to catecholamine [inference]

cellular response to catecholamine stimulus

cellular response to oxygen-containing compound [inference]

cellular response to catecholamine stimulus

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to monoamine stimulus [inference]

cellular response to catecholamine stimulus

cellular response to oxygen-containing compound [inference]

cellular response to catecholamine stimulus

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signaling [inference]

negative regulation of synaptic transmission [inference]

long-term synaptic depression

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic plasticity [inference]

long-term synaptic depression

negative regulation of synaptic transmission [inference]

long-term synaptic depression

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of synaptic transmission [inference]

long-term synaptic depression

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of synaptic transmission [inference]

long-term synaptic depression

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-modulating G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-activating G protein-coupled receptor signaling pathway

G protein-coupled dopamine receptor signaling pathway

adenylate cyclase-activating dopamine receptor signaling pathway

adrenergic receptor signaling pathway [inference]

adenylate cyclase-activating adrenergic receptor signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of cell communication [inference]

negative regulation of synaptic transmission [inference]

long-term synaptic depression

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic plasticity [inference]

long-term synaptic depression

negative regulation of synaptic transmission [inference]

long-term synaptic depression

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of synaptic transmission [inference]

long-term synaptic depression

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of biological quality [inference]

regulation of blood pressure [inference]

regulation of systemic arterial blood pressure [inference]

regulation of systemic arterial blood pressure mediated by a chemical signal [inference]

regulation of systemic arterial blood pressure by hormone [inference]

regulation of systemic arterial blood pressure by vasopressin

negative regulation of blood pressure

regulation of female receptivity

regulation of synaptic plasticity [inference]

long-term synaptic depression

regulation of anatomical structure size [inference]

regulation of tube size [inference]

regulation of tube diameter [inference]

blood vessel diameter maintenance [inference]

vasoconstriction [inference]

norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure

regulation of postsynaptic membrane neurotransmitter receptor levels

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	ISO	GO_REF
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF GO_REF GO_REF
cilium	ISO	PMID
cilium	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle membrane [inference]

bounding membrane of organelle [inference]

ciliary membrane

plasma membrane region [inference]

cell projection membrane [inference]

synaptic membrane [inference]

postsynaptic specialization membrane [inference]

postsynaptic density membrane

cell junction [inference]

synapse [inference]

glutamatergic synapse

cell projection [inference]

plasma membrane bounded cell projection [inference]

cilium

non-motile cilium

9+0 non-motile cilium

neuron projection [inference]

neuron spine [inference]

dendritic spine

organelle [inference]

membrane-bounded organelle [inference]

cilium

non-motile cilium

9+0 non-motile cilium

cell body [inference]

neuronal cell body

postsynapse [inference]

dendritic spine

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
dopamine neurotransmitter receptor activity, coupled via Gs	ISO	GO_REF
dopamine neurotransmitter receptor activity, coupled via Gs	IDA	PMID
dopamine neurotransmitter receptor activity, coupled via Gs	IMP	PMID
dopamine neurotransmitter receptor activity, coupled via Gs	IBA	GO_REF
dopamine neurotransmitter receptor activity, coupled via Gs	IEA	GO_REF GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

G-protein alpha-subunit binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

dopamine binding

catecholamine binding [inference]

dopamine binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity

neurotransmitter receptor activity [inference]

postsynaptic neurotransmitter receptor activity [inference]

dopamine neurotransmitter receptor activity

dopamine neurotransmitter receptor activity, coupled via Gs

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLPPGRNGTAHRARLGLQRQLAQVDAPGGSAAPLGPAQVVTAGLLTLLIVWTLLGNVLVCAAIVRSRHLRAKMTNIFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDIWVAFDIMCSTASILNLCIISVDRYWAISRPFRYERKMTQRVALVMVALAWTLSILISFIPVQLNWHRDKAGSQGREGLLSNETPWEEGWELDGRTENCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSRGACEPDPSLRASIKKETKVFKTLSVIMGVFVCCWLPFFILNCMVPFCSSGDAQGPRTGFPCVSETTFDIFVWFGWANSSLNPIIYAFNADFRKVFAQLLGCSHLCFRTPVQTVNISNELISYNQDTVFHREIAAAYVHMIPNAVSSGDREVGEEEEAEEEGPFDHMSQISPTTPDGDLAAESVWELDCEEEVSLGKISPLTPNCFHKTA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
7	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Dopamine receptors	Mus musculus
G alpha (s) signalling events	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements