GlyCosmos Portal

Submissions

9530003J23Rik protein

Summary

UniProt ID: Q8BM26
Gene Symbol: Lyz3 9530003J23Rik Lyzf1
Gene ID: 77397
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0006285
Re-Glyco: Q8BM26

Annotation

Keyword: Disulfide bond Proteomics identification Reference proteome Signal

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
killing of cells of another organism	ISO	GO_REF
defense response to bacterium	ISO	GO_REF
defense response to Gram-negative bacterium	IBA	GO_REF
defense response to Gram-positive bacterium	ISO	GO_REF
defense response to Gram-positive bacterium	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell killing [inference]

killing of cells of another organism

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium

disruption of anatomical structure in another organism [inference]

disruption of cell in another organism [inference]

killing of cells of another organism

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to bacterium

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying **all 3** entries
GO Term	Evidence Code	Reference
lysozyme activity	IBA	GO_REF
lysozyme activity	IEA	GO_REF
identical protein binding	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on glycosyl bonds [inference]

hydrolase activity, hydrolyzing O-glycosyl compounds [inference]

lysozyme activity

peptidoglycan muralytic activity [inference]

lysozyme activity

binding [inference]

protein binding [inference]

identical protein binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKAPLTLLTLGLLLLSITIQGKVYDRCSLARTLQSLGLAGFQGITLANWVCLAKWESNFNTNTTRFNPEDQSTSYGIFQINSRFWCNDGKTPGSRNFCRISCKALLKSNIWSAVVCAKRIVKDPQGIYSWAGWIKHCKNKNLKEYIRGCHL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites