GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Spondin-2

Summary

UniProt ID: Q8BMS2
Gene Symbol: Spon2
Gene ID: 100689
Organism: Mus musculus (house mouse)

External Links

PubChem: Q8BMS2
Re-Glyco: Q8BMS2

Annotation

Keyword: Calcium Cell adhesion Disulfide bond Extracellular matrix Glycoprotein Innate immunity Metal-binding Reference proteome Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 23 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
mast cell mediated immunity	IMP	PMID
cell adhesion	ISO	GO_REF
cell adhesion	IBA	GO_REF
cell adhesion	IEA	GO_REF
opsonization	IDA	PMID

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

leukocyte mediated immunity [inference]

myeloid leukocyte mediated immunity [inference]

mast cell mediated immunity

opsonization

immune response [inference]

humoral immune response [inference]

antimicrobial humoral response [inference]

antibacterial humoral response [inference]

induction of bacterial agglutination

innate immune response

cellular process [inference]

cell adhesion

cell population proliferation [inference]

muscle cell proliferation [inference]

smooth muscle cell proliferation [inference]

vascular associated smooth muscle cell proliferation

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to lipid [inference]

cellular response to lipopolysaccharide

cellular response to oxygen-containing compound [inference]

cellular response to lipopolysaccharide

cellular response to biotic stimulus [inference]

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to virus [inference]

defense response to virus

response to bacterium [inference]

defense response to bacterium

antibacterial humoral response [inference]

induction of bacterial agglutination

response to fungus [inference]

defense response to fungus

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

antibacterial humoral response [inference]

induction of bacterial agglutination

innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to bacterium

antibacterial humoral response [inference]

induction of bacterial agglutination

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

antibacterial humoral response [inference]

induction of bacterial agglutination

innate immune response

immune response [inference]

humoral immune response [inference]

antimicrobial humoral response [inference]

antibacterial humoral response [inference]

induction of bacterial agglutination

innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

cellular response to lipopolysaccharide

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

response to other organism [inference]

response to virus [inference]

defense response to virus

response to bacterium [inference]

defense response to bacterium

antibacterial humoral response [inference]

induction of bacterial agglutination

response to fungus [inference]

defense response to fungus

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

antibacterial humoral response [inference]

induction of bacterial agglutination

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

cellular response to lipopolysaccharide

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

response to other organism [inference]

response to virus [inference]

defense response to virus

response to bacterium [inference]

defense response to bacterium

antibacterial humoral response [inference]

induction of bacterial agglutination

response to fungus [inference]

defense response to fungus

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

antibacterial humoral response [inference]

induction of bacterial agglutination

innate immune response

cellular response to biotic stimulus [inference]

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

response to endogenous stimulus [inference]

response to growth factor [inference]

response to platelet-derived growth factor [inference]

cellular response to platelet-derived growth factor stimulus

cellular response to growth factor stimulus [inference]

cellular response to platelet-derived growth factor stimulus

cellular response to endogenous stimulus [inference]

cellular response to growth factor stimulus [inference]

cellular response to platelet-derived growth factor stimulus

response to chemical [inference]

response to lipid [inference]

response to lipopolysaccharide

cellular response to lipopolysaccharide

cellular response to lipid [inference]

cellular response to lipopolysaccharide

cellular response to chemical stimulus [inference]

cellular response to lipid [inference]

cellular response to lipopolysaccharide

cellular response to oxygen-containing compound [inference]

cellular response to lipopolysaccharide

response to oxygen-containing compound [inference]

response to lipopolysaccharide

cellular response to lipopolysaccharide

cellular response to oxygen-containing compound [inference]

cellular response to lipopolysaccharide

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to lipid [inference]

cellular response to lipopolysaccharide

cellular response to oxygen-containing compound [inference]

cellular response to lipopolysaccharide

cellular response to biotic stimulus [inference]

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

regulation of immune effector process [inference]

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

regulation of production of molecular mediator of immune response [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

regulation of cytokine production involved in immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

regulation of macrophage cytokine production [inference]

positive regulation of macrophage cytokine production

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of interleukin-6 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of interleukin-6 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of interleukin-6 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of interleukin-6 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of interleukin-6 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of cytokine production involved in immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

regulation of macrophage cytokine production [inference]

positive regulation of macrophage cytokine production

regulation of interleukin-6 production [inference]

positive regulation of interleukin-6 production

regulation of tumor necrosis factor superfamily cytokine production [inference]

regulation of tumor necrosis factor production [inference]

positive regulation of tumor necrosis factor production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of production of molecular mediator of immune response [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

regulation of cytokine production involved in immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

regulation of macrophage cytokine production [inference]

positive regulation of macrophage cytokine production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of interleukin-6 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of interleukin-6 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of interleukin-6 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of interleukin-6 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of interleukin-6 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of cytokine production involved in immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

regulation of macrophage cytokine production [inference]

positive regulation of macrophage cytokine production

regulation of interleukin-6 production [inference]

positive regulation of interleukin-6 production

regulation of tumor necrosis factor superfamily cytokine production [inference]

regulation of tumor necrosis factor production [inference]

positive regulation of tumor necrosis factor production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of production of molecular mediator of immune response [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

regulation of cytokine production involved in immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

regulation of macrophage cytokine production [inference]

positive regulation of macrophage cytokine production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of interleukin-6 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of interleukin-6 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of interleukin-6 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of interleukin-6 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of interleukin-6 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of interleukin-6 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of cytokine production involved in immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

regulation of macrophage cytokine production [inference]

positive regulation of macrophage cytokine production

regulation of interleukin-6 production [inference]

positive regulation of interleukin-6 production

regulation of tumor necrosis factor superfamily cytokine production [inference]

regulation of tumor necrosis factor production [inference]

positive regulation of tumor necrosis factor production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of myeloid leukocyte cytokine production involved in immune response [inference]

positive regulation of macrophage cytokine production

positive regulation of interleukin-6 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

Displaying **all 3** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
extracellular matrix	IDA	PMID
extracellular matrix	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

external encapsulating structure [inference]

extracellular matrix

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
lipopolysaccharide binding	IDA	PMID
antigen binding	IDA	PMID
antigen binding	IMP	PMID
signaling receptor binding	ISO	GO_REF
signaling receptor binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

antigen binding

protein binding [inference]

signaling receptor binding

lipid binding [inference]

lipopolysaccharide binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

carbohydrate derivative binding [inference]

lipopolysaccharide binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MENVSLALGRALWVFLLAMIGSTTSQPLGGESVCTARPLARYSITFIGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNEYVSNGLRDFAERGEAWALMKEIEAAGEKLQSVHAVFSAPAIPSGTGQTSTELEVHPRHSLVSFVVRIVPSPDWFVGIDSLDLCEGGRWKEQVVLDLYPHDAGTDSGFTFSSPNFATIPQDTVTEITASSPSHPANSFYYPRLKSLPPIAKVTFVRLQQSPRAFAPPSLDLASRGNEIVDSLSVPETPLDCEVSLWSSWGLCGGPCGKLGAKSRTRYVRVQPANNGTPCPELEEEAECAPDNCV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
282	C-linked (Man) tryptophan			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
O-glycosylation of TSR domain-containing proteins	Mus musculus

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026