GlyCosmos Portal

Submissions

Synaptic vesicular amine transporter

Summary

UniProt ID: Q8BRU6
Gene Symbol: Slc18a2 Vmat2
Gene ID: 214084
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q8BRU6
PubChem: Q8BRU6
Re-Glyco: Q8BRU6

Annotation

Keyword: Cell projection Cytoplasmic vesicle Disulfide bond Glycoprotein Neurotransmitter transport Phosphoprotein Reference proteome Synapse Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 22 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
response to amphetamine	IMP	PMID
serotonin secretion by mast cell	IMP	PMID
histamine secretion by mast cell	IMP	PMID
neurotransmitter transport	ISO	GO_REF
neurotransmitter transport	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

intercellular transport [inference]

neurotransmitter loading into synaptic vesicle

aminergic neurotransmitter loading into synaptic vesicle

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to xenobiotic stimulus

exocytic process [inference]

export from cell [inference]

secretion by cell [inference]

protein secretion [inference]

insulin secretion

signal release [inference]

serotonin secretion [inference]

serotonin secretion involved in inflammatory response [inference]

serotonin secretion by mast cell

dopamine secretion [inference]

somato-dendritic dopamine secretion

hormone secretion [inference]

histamine secretion involved in inflammatory response [inference]

histamine secretion by mast cell

peptide hormone secretion [inference]

insulin secretion

catecholamine secretion [inference]

dopamine secretion [inference]

somato-dendritic dopamine secretion

multicellular organismal process [inference]

behavior [inference]

locomotory behavior

post-embryonic development

response to stimulus [inference]

response to chemical [inference]

response to xenobiotic stimulus [inference]

cellular response to xenobiotic stimulus

response to toxic substance

cellular response to chemical stimulus [inference]

cellular response to xenobiotic stimulus

response to nitrogen compound [inference]

response to amine [inference]

response to amphetamine

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to xenobiotic stimulus

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

protein secretion [inference]

insulin secretion

protein localization to extracellular region [inference]

protein secretion [inference]

insulin secretion

establishment of localization [inference]

transport [inference]

neurotransmitter transport

neurotransmitter uptake [inference]

histamine uptake

neurotransmitter reuptake [inference]

serotonin uptake

neurotransmitter loading into synaptic vesicle

aminergic neurotransmitter loading into synaptic vesicle

hormone transport [inference]

hormone secretion [inference]

histamine secretion involved in inflammatory response [inference]

histamine secretion by mast cell

peptide hormone secretion [inference]

insulin secretion

intercellular transport [inference]

neurotransmitter loading into synaptic vesicle

aminergic neurotransmitter loading into synaptic vesicle

protein transport [inference]

protein secretion [inference]

insulin secretion

peptide transport [inference]

peptide secretion [inference]

peptide hormone secretion [inference]

insulin secretion

organic hydroxy compound transport [inference]

serotonin transport [inference]

serotonin secretion [inference]

serotonin secretion involved in inflammatory response [inference]

serotonin secretion by mast cell

serotonin uptake

catecholamine transport [inference]

dopamine transport [inference]

dopamine secretion [inference]

somato-dendritic dopamine secretion

catecholamine secretion [inference]

dopamine secretion [inference]

somato-dendritic dopamine secretion

secretion [inference]

histamine secretion [inference]

histamine secretion involved in inflammatory response [inference]

histamine secretion by mast cell

peptide secretion [inference]

peptide hormone secretion [inference]

insulin secretion

secretion by cell [inference]

protein secretion [inference]

insulin secretion

signal release [inference]

serotonin secretion [inference]

serotonin secretion involved in inflammatory response [inference]

serotonin secretion by mast cell

dopamine secretion [inference]

somato-dendritic dopamine secretion

hormone secretion [inference]

histamine secretion involved in inflammatory response [inference]

histamine secretion by mast cell

peptide hormone secretion [inference]

insulin secretion

catecholamine secretion [inference]

dopamine secretion [inference]

somato-dendritic dopamine secretion

nitrogen compound transport [inference]

amine transport [inference]

aminergic neurotransmitter loading into synaptic vesicle

monoamine transport

serotonin transport [inference]

serotonin secretion [inference]

serotonin secretion involved in inflammatory response [inference]

serotonin secretion by mast cell

serotonin uptake

catecholamine transport [inference]

dopamine transport [inference]

dopamine secretion [inference]

somato-dendritic dopamine secretion

catecholamine secretion [inference]

dopamine secretion [inference]

somato-dendritic dopamine secretion

peptide hormone secretion [inference]

insulin secretion

histamine transport [inference]

histamine secretion [inference]

histamine secretion involved in inflammatory response [inference]

histamine secretion by mast cell

histamine uptake

import into cell [inference]

neurotransmitter uptake [inference]

histamine uptake

neurotransmitter reuptake [inference]

serotonin uptake

export from cell [inference]

secretion by cell [inference]

protein secretion [inference]

insulin secretion

signal release [inference]

serotonin secretion [inference]

serotonin secretion involved in inflammatory response [inference]

serotonin secretion by mast cell

dopamine secretion [inference]

somato-dendritic dopamine secretion

hormone secretion [inference]

histamine secretion involved in inflammatory response [inference]

histamine secretion by mast cell

peptide hormone secretion [inference]

insulin secretion

catecholamine secretion [inference]

dopamine secretion [inference]

somato-dendritic dopamine secretion

establishment of protein localization [inference]

protein transport [inference]

protein secretion [inference]

insulin secretion

establishment of protein localization to extracellular region [inference]

protein secretion [inference]

insulin secretion

establishment of localization in cell [inference]

neurotransmitter loading into synaptic vesicle

aminergic neurotransmitter loading into synaptic vesicle

neurotransmitter reuptake [inference]

serotonin uptake

somato-dendritic dopamine secretion

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

negative regulation of transport [inference]

negative regulation of neurotransmitter transport

regulation of neurotransmitter transport [inference]

negative regulation of neurotransmitter transport

negative regulation of biological process [inference]

negative regulation of transport [inference]

negative regulation of neurotransmitter transport

regulation of biological quality [inference]

regulation of hormone levels [inference]

hormone transport [inference]

hormone secretion [inference]

histamine secretion involved in inflammatory response [inference]

histamine secretion by mast cell

peptide hormone secretion [inference]

insulin secretion

Displaying entries **1 - 5** of 27 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
centrosome	ISO	GO_REF
synaptic vesicle	ISO	GO_REF
axon	ISS	GO_REF
axon	ISO	GO_REF
axon	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

microtubule organizing center [inference]

centrosome

membrane [inference]

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

transport vesicle membrane [inference]

exocytic vesicle membrane [inference]

synaptic vesicle membrane

secretory granule membrane

dense core granule membrane [inference]

neuronal dense core vesicle membrane

bounding membrane of organelle [inference]

transport vesicle membrane [inference]

exocytic vesicle membrane [inference]

synaptic vesicle membrane

secretory granule membrane

dense core granule membrane [inference]

neuronal dense core vesicle membrane

cell junction [inference]

synapse [inference]

dopaminergic synapse

cell projection

plasma membrane bounded cell projection [inference]

neuron projection [inference]

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

secretory granule [inference]

dense core granule

neuronal dense core vesicle

exocytic vesicle [inference]

synaptic vesicle

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

secretory granule [inference]

dense core granule

neuronal dense core vesicle

exocytic vesicle [inference]

synaptic vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

secretory granule [inference]

dense core granule

neuronal dense core vesicle

exocytic vesicle [inference]

synaptic vesicle

cell body

neuronal cell body

neuron projection terminus [inference]

axon terminus

presynapse [inference]

postsynapse

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
amine transmembrane transporter activity	ISO	GO_REF
serotonin:sodium:chloride symporter activity	IBA	GO_REF
monoamine:proton antiporter activity	ISO	GO_REF GO_REF
monoamine:proton antiporter activity	IEA	GO_REF
enzyme binding	ISO	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

amine transmembrane transporter activity

monoatomic ion transmembrane transporter activity [inference]

monoatomic cation transmembrane transporter activity [inference]

proton transmembrane transporter activity [inference]

monoamine:proton antiporter activity

solute:monoatomic cation symporter activity [inference]

monoatomic anion:monoatomic cation symporter activity [inference]

monoatomic anion:sodium symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

chloride:monoatomic cation symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

solute:sodium symporter activity [inference]

monoatomic anion:sodium symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

metal ion transmembrane transporter activity [inference]

sodium ion transmembrane transporter activity [inference]

solute:sodium symporter activity [inference]

monoatomic anion:sodium symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

monoatomic anion transmembrane transporter activity [inference]

chloride transmembrane transporter activity [inference]

chloride:monoatomic cation symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

monoatomic anion:monoatomic cation symporter activity [inference]

monoatomic anion:sodium symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

chloride:monoatomic cation symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

active transmembrane transporter activity [inference]

monoamine transmembrane transporter activity [inference]

secondary active transmembrane transporter activity [inference]

symporter activity [inference]

solute:monoatomic cation symporter activity [inference]

monoatomic anion:monoatomic cation symporter activity [inference]

monoatomic anion:sodium symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

chloride:monoatomic cation symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

solute:sodium symporter activity [inference]

monoatomic anion:sodium symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

antiporter activity [inference]

monoamine:proton antiporter activity

xenobiotic transmembrane transporter activity

binding [inference]

protein binding [inference]

small molecule binding [inference]

heterocyclic compound binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MALSDLVLLRWLRDSRHSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNTTEIQTARPALTASTSESFHSIFSYYNNSTVFTGNATGGLPGGESPKATTTQHTVTNTTVPPDCPSEDKDLLNENVQVGLLFASKATVQLLTNPFIGLLTNRIGYPIPMFAGFCIMFISTVMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNAMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLCALLGMIVVGISILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDIVFAPLCFFLRSPPAKEEKMAILMDHNCPIKTKMYTQNNVQPYPVGDDEESESD

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	GlyTouCan ID	Source
56	N-linked (GlcNAc...) asparagine	G80920RR	UniProt GlyGen
83	N-linked (GlcNAc...) asparagine		UniProt GlyGen
84	N-linked (GlcNAc...) asparagine		UniProt GlyGen
91	N-linked (GlcNAc...) asparagine		UniProt GlyGen
113	N-linked (GlcNAc...) asparagine		UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Dopamine Neurotransmitter Release Cycle	Mus musculus
Norepinephrine Neurotransmitter Release Cycle	Mus musculus
Serotonin Neurotransmitter Release Cycle	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements