GlyCosmos Portal

Submissions

Uronyl 2-sulfotransferase

Summary

UniProt ID: Q8BUB6
Gene Symbol: Ust
Gene ID: 338362
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0006390
PubChem: Q8BUB6
Re-Glyco: Q8BUB6

Annotation

Keyword: Glycoprotein Golgi apparatus Reference proteome Signal-anchor Transferase Transmembrane helix

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
establishment of cell polarity	IMP	PMID
dermatan sulfate proteoglycan biosynthetic process	ISO	GO_REF
dermatan sulfate proteoglycan biosynthetic process	IEA	GO_REF
regulation of axonogenesis	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

establishment or maintenance of cell polarity [inference]

establishment of cell polarity

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via xylose [inference]

dermatan sulfate proteoglycan biosynthetic process

proteoglycan biosynthetic process [inference]

dermatan sulfate proteoglycan biosynthetic process

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via xylose [inference]

dermatan sulfate proteoglycan biosynthetic process

proteoglycan biosynthetic process [inference]

dermatan sulfate proteoglycan biosynthetic process

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via xylose [inference]

dermatan sulfate proteoglycan biosynthetic process

proteoglycan biosynthetic process [inference]

dermatan sulfate proteoglycan biosynthetic process

protein metabolic process [inference]

glycoprotein metabolic process [inference]

proteoglycan metabolic process [inference]

proteoglycan biosynthetic process [inference]

dermatan sulfate proteoglycan biosynthetic process

dermatan sulfate proteoglycan metabolic process [inference]

dermatan sulfate proteoglycan biosynthetic process

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via xylose [inference]

dermatan sulfate proteoglycan biosynthetic process

proteoglycan biosynthetic process [inference]

dermatan sulfate proteoglycan biosynthetic process

primary metabolic process [inference]

protein metabolic process [inference]

glycoprotein metabolic process [inference]

proteoglycan metabolic process [inference]

proteoglycan biosynthetic process [inference]

dermatan sulfate proteoglycan biosynthetic process

dermatan sulfate proteoglycan metabolic process [inference]

dermatan sulfate proteoglycan biosynthetic process

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via xylose [inference]

dermatan sulfate proteoglycan biosynthetic process

proteoglycan biosynthetic process [inference]

dermatan sulfate proteoglycan biosynthetic process

carbohydrate derivative metabolic process [inference]

glycoprotein metabolic process [inference]

proteoglycan metabolic process [inference]

proteoglycan biosynthetic process [inference]

dermatan sulfate proteoglycan biosynthetic process

dermatan sulfate proteoglycan metabolic process [inference]

dermatan sulfate proteoglycan biosynthetic process

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via xylose [inference]

dermatan sulfate proteoglycan biosynthetic process

proteoglycan biosynthetic process [inference]

dermatan sulfate proteoglycan biosynthetic process

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via xylose [inference]

dermatan sulfate proteoglycan biosynthetic process

proteoglycan biosynthetic process [inference]

dermatan sulfate proteoglycan biosynthetic process

biological regulation [inference]

regulation of biological process [inference]

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of axonogenesis

regulation of cellular process [inference]

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development [inference]

regulation of axonogenesis

Displaying 1 entry
GO Term	Evidence Code	Reference
Golgi membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

bounding membrane of organelle [inference]

Golgi membrane

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
sulfotransferase activity	IBA	GO_REF
sulfotransferase activity	IEA	GO_REF
chondroitin 2-sulfotransferase activity	ISS	GO_REF
chondroitin 2-sulfotransferase activity	ISO	GO_REF
chondroitin 2-sulfotransferase activity	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring sulphur-containing groups [inference]

sulfotransferase activity

proteoglycan sulfotransferase activity [inference]

chondroitin sulfotransferase activity [inference]

chondroitin 2-sulfotransferase activity

dermatan sulfotransferase activity [inference]

dermatan 2-sulfotransferase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

3'-phosphoadenosine 5'-phosphosulfate binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

3'-phosphoadenosine 5'-phosphosulfate binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

3'-phosphoadenosine 5'-phosphosulfate binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

3'-phosphoadenosine 5'-phosphosulfate binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

3'-phosphoadenosine 5'-phosphosulfate binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

3'-phosphoadenosine 5'-phosphosulfate binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

3'-phosphoadenosine 5'-phosphosulfate binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

3'-phosphoadenosine 5'-phosphosulfate binding

sulfur compound binding [inference]

3'-phosphoadenosine 5'-phosphosulfate binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKKKQQQHPGGGTDPWPHGAPVGGAPPCLGSCKRRIPLLPFLRFSLRDYGFCMATLLVFCLGSLFYQLSGGPPRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVLLLRILSEKHGFNLVTSDIHNKTRLTKNEQMELIKNISTAEQPYLFTRHVHFLNFSRFGGDQPVYINIIRDPVSRFLSNYFFRRFGDWRGEQNHMIRTPSMRQEERYLDINECILENYPECSNPRLFYIIPYFCGQHPRCREPGEWALERAKLNVNENFLLVGILEELEDVLLLLERFLPHYFKGVLSIYKDPEHRKLGNMTVTVRKTVPSPEAVQILYQRMRYEYEFYHYVREQFHLLKRKLGLKSRVSGPPVRPQFFIPTPLETEEPIDDEEQDDEKWLEDIYKR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	Source
85	N-linked (GlcNAc...) asparagine	UniProt
141	N-linked (GlcNAc...) asparagine	GlycoProtDB UniProt
156	N-linked (GlcNAc...) asparagine	UniProt
174	N-linked (GlcNAc...) asparagine	UniProt
320	N-linked (GlcNAc...) asparagine	GlycoProtDB UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
CS-GAG biosynthesis	Mus musculus
DS-GAG biosynthesis	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements