GlyCosmos Portal

Submissions

Rho GTPase-activating protein 24

Summary

UniProt ID: Q8C4V1
Gene Symbol: Arhgap24
Gene ID: 231532
Organism: Mus musculus (house mouse)

External Links

The O-GlcNAc Database: Q8C4V1
Re-Glyco: Q8C4V1

Annotation

Keyword: Alternative splicing Angiogenesis Cell junction Cell projection Coiled coil Cytoskeleton Developmental protein Differentiation GTPase activation Phosphoprotein Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
angiogenesis
signal transduction	IEA	GO_REF
cell differentiation
negative regulation of Rac protein signal transduction	IMP	PMID
negative regulation of Rac protein signal transduction	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction

cellular developmental process [inference]

cell differentiation

cell motility [inference]

cell migration [inference]

wound healing, spreading of cells [inference]

wound healing, spreading of epidermal cells

developmental process [inference]

anatomical structure formation involved in morphogenesis [inference]

angiogenesis

cellular developmental process [inference]

cell differentiation

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of small GTPase mediated signal transduction [inference]

negative regulation of Rac protein signal transduction

regulation of intracellular signal transduction [inference]

regulation of small GTPase mediated signal transduction [inference]

regulation of Rac protein signal transduction [inference]

negative regulation of Rac protein signal transduction

negative regulation of small GTPase mediated signal transduction [inference]

negative regulation of Rac protein signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of small GTPase mediated signal transduction [inference]

negative regulation of Rac protein signal transduction

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of small GTPase mediated signal transduction [inference]

negative regulation of Rac protein signal transduction

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of small GTPase mediated signal transduction [inference]

negative regulation of Rac protein signal transduction

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of small GTPase mediated signal transduction [inference]

negative regulation of Rac protein signal transduction

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of ruffle assembly

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of small GTPase mediated signal transduction [inference]

negative regulation of Rac protein signal transduction

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of small GTPase mediated signal transduction [inference]

negative regulation of Rac protein signal transduction

regulation of intracellular signal transduction [inference]

regulation of small GTPase mediated signal transduction [inference]

regulation of Rac protein signal transduction [inference]

negative regulation of Rac protein signal transduction

negative regulation of small GTPase mediated signal transduction [inference]

negative regulation of Rac protein signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of small GTPase mediated signal transduction [inference]

negative regulation of Rac protein signal transduction

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of small GTPase mediated signal transduction [inference]

negative regulation of Rac protein signal transduction

regulation of cellular process [inference]

signal transduction

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of small GTPase mediated signal transduction [inference]

negative regulation of Rac protein signal transduction

regulation of intracellular signal transduction [inference]

regulation of small GTPase mediated signal transduction [inference]

regulation of Rac protein signal transduction [inference]

negative regulation of Rac protein signal transduction

negative regulation of small GTPase mediated signal transduction [inference]

negative regulation of Rac protein signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of small GTPase mediated signal transduction [inference]

negative regulation of Rac protein signal transduction

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of small GTPase mediated signal transduction [inference]

negative regulation of Rac protein signal transduction

regulation of cellular component biogenesis [inference]

regulation of cell projection assembly [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of ruffle assembly

regulation of ruffle assembly [inference]

negative regulation of ruffle assembly

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of small GTPase mediated signal transduction [inference]

negative regulation of Rac protein signal transduction

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of ruffle assembly

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of ruffle assembly

regulation of cell projection assembly [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of ruffle assembly

regulation of ruffle assembly [inference]

negative regulation of ruffle assembly

regulation of plasma membrane bounded cell projection organization [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of ruffle assembly

regulation of ruffle assembly [inference]

negative regulation of ruffle assembly

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of ruffle assembly

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cytoskeleton	IEA	GO_REF
adherens junction	IEA	GO_REF
focal adhesion	IDA	PMID
focal adhesion	IBA	GO_REF
focal adhesion	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell junction [inference]

anchoring junction [inference]

cell-cell junction [inference]

adherens junction

cell-substrate junction [inference]

focal adhesion

cell projection

organelle [inference]

membraneless organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton

intracellular organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton

Displaying **all 2** entries
GO Term	Evidence Code	Reference
GTPase activator activity	IMP	PMID
GTPase activator activity	IBA	GO_REF

GO Hierarchy

molecular function

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme activator activity [inference]

GTPase activator activity

nucleoside-triphosphatase regulator activity [inference]

GTPase regulator activity [inference]

GTPase activator activity

molecular function activator activity [inference]

enzyme activator activity [inference]

GTPase activator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEERCESTESPQGQGRKNTKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPLGTIFLHGNKVIEHPCNEENPGKFLFDVVPGGERDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVVPYAKYEDFLSCATLLSKEEEAGVKELMKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSAQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDRLFPKDTEPQSKPQDGPNSNNNDGHKKATMGQLQNKENNNTKESPVRRCSWDKPESPQRSSVDNGSPTALSGSKTNSPRNSIHKLDISRSPPLMVKKNPAFNKGSGIVTNGSFSSSNAEGVEKPQTTPNGSLQARRTSSLKSSGTKMGTHSVQNGTVRMGILNTDTLGNSLNGRSMSWLPNGYVTLRDNKQKEPAGESGQHNRLSTYDNVHQQFSSMSLDDKHSVDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFYVGNFEDPVLDGPPQDDLSHPGDYENKSDRRSVGGRSSRATSSSDNSETFVGNTSSNHSALHSLVSSLKQEMTKQKIEYESRIKSLEQRNLTLETEMLSLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQKEMEQFFSTFGDLTVEPRRSERGNTIWIQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites