GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Major intrinsically disordered NOTCH2-binding receptor 1-like homolog

Summary

UniProt ID: Q8C4X7
Gene Symbol: Minar2
Gene ID: 225583
Organism: Mus musculus (house mouse)

External Links

Re-Glyco: Q8C4X7

Annotation

Keyword: Alternative splicing Endoplasmic reticulum Glycoprotein Lysosome Phosphoprotein Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
angiogenesis	ISS	GO_REF
angiogenesis	ISO	GO_REF
apoptotic process	IMP	PMID
sensory perception of sound	ISS	PMID
sensory perception of sound	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

gene expression

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

gene expression

cell death [inference]

programmed cell death [inference]

apoptotic process

neuron apoptotic process

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation [inference]

hair cell differentiation [inference]

inner ear auditory receptor cell differentiation

mechanoreceptor differentiation [inference]

inner ear receptor cell differentiation

inner ear auditory receptor cell differentiation

epithelial cell differentiation [inference]

epidermal cell differentiation [inference]

hair cell differentiation [inference]

inner ear auditory receptor cell differentiation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

inner ear receptor cell stereocilium organization

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

sensory perception [inference]

sensory perception of mechanical stimulus [inference]

sensory perception of sound

behavior [inference]

locomotory behavior

walking behavior

exploration behavior

multicellular organismal-level homeostasis [inference]

homeostasis of number of cells [inference]

homeostasis of number of cells within a tissue

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

homeostasis of number of cells within a tissue

developmental process [inference]

anatomical structure formation involved in morphogenesis [inference]

angiogenesis

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation [inference]

hair cell differentiation [inference]

inner ear auditory receptor cell differentiation

mechanoreceptor differentiation [inference]

inner ear receptor cell differentiation

inner ear auditory receptor cell differentiation

epithelial cell differentiation [inference]

epidermal cell differentiation [inference]

hair cell differentiation [inference]

inner ear auditory receptor cell differentiation

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

homeostasis of number of cells [inference]

homeostasis of number of cells within a tissue

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

homeostasis of number of cells within a tissue

chemical homeostasis [inference]

lipid homeostasis [inference]

sterol homeostasis [inference]

cholesterol homeostasis

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
lysosomal membrane	ISS	GO_REF
lysosomal membrane	IDA	PMID
lysosomal membrane	IEA	GO_REF
endoplasmic reticulum	ISS	GO_REF
endoplasmic reticulum	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

endoplasmic reticulum membrane

bounding membrane of organelle [inference]

vacuolar membrane [inference]

lytic vacuole membrane [inference]

lysosomal membrane

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

stereocilium

actin-based cell projection [inference]

stereocilium

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

Displaying **all 2** entries
GO Term	Evidence Code	Reference
cholesterol binding	ISS	GO_REF
cholesterol binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

lipid binding [inference]

steroid binding [inference]

sterol binding [inference]

cholesterol binding

small molecule binding [inference]

alcohol binding [inference]

cholesterol binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKGDMDLSVLPNNNHPDKFLQLDVKSLMRSSTLLQASLARFPGGNYPATQHWQNLVYSQREKTIATQRIKGFGVENPVLPESPPASMSSVMKNNPLYGDITLEEAMEERKKSPSWTIEEYDKHSVHTNLSGHLKENPNDLRFWLGDTYTPGFDTLLKKKKKRNKRSKLCHMGLILLLVASILVTIVTLSTIFS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
128	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:14330	Parkinson's disease	Alliance of Genome Resources

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026