GlyCosmos Portal

Submissions

NAD kinase 2, mitochondrial

Summary

UniProt ID: Q8C5H8
Gene Symbol: Mnadk Nadk2 Nadkd1
Gene ID: 68646
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q8C5H8
PubChem: Q8C5H8
The O-GlcNAc Database: Q8C5H8
Re-Glyco: Q8C5H8

Annotation

Keyword: ATP-binding Acetylation Alternative splicing Kinase Mitochondrion NAD NADP Phosphoprotein Reference proteome Transit peptide

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
NADP+ biosynthetic process	IEA	GO_REF
NAD+ metabolic process	ISS	GO_REF
NAD+ metabolic process	ISO	GO_REF
NAD+ metabolic process	IBA	GO_REF
NAD+ metabolic process	IEA	GO_REF GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

NADP+ metabolic process [inference]

NADP+ biosynthetic process

NAD+ metabolic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

pyridine nucleotide biosynthetic process [inference]

nicotinamide nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

nicotinamide nucleotide metabolic process [inference]

NADP+ metabolic process [inference]

NADP+ biosynthetic process

nicotinamide nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

NAD+ metabolic process

nucleoside phosphate biosynthetic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

pyridine nucleotide biosynthetic process [inference]

nicotinamide nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

NADP+ metabolic process [inference]

NADP+ biosynthetic process

NAD+ metabolic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

pyridine nucleotide biosynthetic process [inference]

nicotinamide nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

nicotinamide nucleotide metabolic process [inference]

NADP+ metabolic process [inference]

NADP+ biosynthetic process

nicotinamide nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

NAD+ metabolic process

nucleoside phosphate biosynthetic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

pyridine nucleotide biosynthetic process [inference]

nicotinamide nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

organophosphate biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

pyridine nucleotide biosynthetic process [inference]

nicotinamide nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

biosynthetic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

pyridine nucleotide biosynthetic process [inference]

nicotinamide nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

pyridine-containing compound biosynthetic process [inference]

pyridine nucleotide biosynthetic process [inference]

nicotinamide nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

organophosphate biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

pyridine nucleotide biosynthetic process [inference]

nicotinamide nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

pyridine nucleotide biosynthetic process [inference]

nicotinamide nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

NADP+ metabolic process [inference]

NADP+ biosynthetic process

NAD+ metabolic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

pyridine nucleotide biosynthetic process [inference]

nicotinamide nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

nicotinamide nucleotide metabolic process [inference]

NADP+ metabolic process [inference]

NADP+ biosynthetic process

nicotinamide nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

NAD+ metabolic process

nucleoside phosphate biosynthetic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

pyridine nucleotide biosynthetic process [inference]

nicotinamide nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

small molecule metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

NADP+ metabolic process [inference]

NADP+ biosynthetic process

NAD+ metabolic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

pyridine nucleotide biosynthetic process [inference]

nicotinamide nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

nicotinamide nucleotide metabolic process [inference]

NADP+ metabolic process [inference]

NADP+ biosynthetic process

nicotinamide nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

NAD+ metabolic process

nucleoside phosphate biosynthetic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

pyridine nucleotide biosynthetic process [inference]

nicotinamide nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

purine-containing compound metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

NADP+ metabolic process [inference]

NADP+ biosynthetic process

NAD+ metabolic process

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

pyridine-containing compound metabolic process [inference]

nicotinamide nucleotide metabolic process [inference]

NADP+ metabolic process [inference]

NADP+ biosynthetic process

nicotinamide nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

NAD+ metabolic process

pyridine-containing compound biosynthetic process [inference]

pyridine nucleotide biosynthetic process [inference]

nicotinamide nucleotide biosynthetic process [inference]

NADP+ biosynthetic process

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrion	ISO	GO_REF
mitochondrion	IBA	GO_REF
mitochondrion	IEA	GO_REF GO_REF
mitochondrion	HDA	PMID
mitochondrial matrix	IMP	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

mitochondrial matrix

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
NAD+ kinase activity	ISS	GO_REF
NAD+ kinase activity	ISO	GO_REF
NAD+ kinase activity	IMP	PMID
NAD+ kinase activity	IBA	GO_REF
NAD+ kinase activity	IEA	GO_REF GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring phosphorus-containing groups [inference]

kinase activity [inference]

NAD+ kinase activity

phosphotransferase activity, alcohol group as acceptor [inference]

NAD+ kinase activity

binding [inference]

protein binding [inference]

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MTCYRGFLLGSCRRVAGGRAALRGSGSGADGRRHLGHGQPRELAGGGSPADGGFRPSRVVVVAKTTRYEFEQQRYRYAELSEEDLKQLLALKGSSYSGLLERHHIHTKNVEHIIDSLRDEGIEVRLVKRREYDEETVRWADAVIAAGGDGTMLLAASKVLDRLKPVIGVNTDPERSEGHLCLPVRYTHSFPEALRRFSRGEFRWLWRQRIRLYLEGTGINPTPVDLHEQQLSLNQHSRAFNIERAHDERSEASGPQLLPVRALNEVFIGESLSSRMPYCWAVAVDNLRRDIPNLKGLASYYEISVDDGPWEKQKSSGLNLCTGTGSKAWSFNINRVAAQAVEDVLHIARRQGNLTLPLNKDLVEKVTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSKVCVRSRCWDACMVVDGGTSFEFNDGAIASMMINKEDELRTVILEQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites