GlyCosmos Portal

Submissions

Histo-blood group ABO system transferase 2

Summary

UniProt ID: Q8CFC4
Gene Symbol: Abo2
Gene ID: 100301568
Organism: Rattus norvegicus (Norway rat)

External Links

PubChem: Q8CFC4
Re-Glyco: Q8CFC4

Annotation

Keyword: Glycoprotein Glycosyltransferase Golgi apparatus Manganese Metal-binding Reference proteome Secreted Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
carbohydrate metabolic process	IEA	GO_REF
positive regulation of cell population proliferation	IMP	PMID
oligosaccharide biosynthetic process	ISO	GO_REF
response to nematode	IEP	PMID
response to retinoic acid	IEP	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

carbohydrate biosynthetic process [inference]

oligosaccharide biosynthetic process

primary metabolic process [inference]

carbohydrate metabolic process

oligosaccharide metabolic process [inference]

oligosaccharide biosynthetic process

carbohydrate biosynthetic process [inference]

oligosaccharide biosynthetic process

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to nematode

response to stimulus [inference]

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to nematode

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to nematode

response to chemical [inference]

response to lipid [inference]

response to retinoic acid

response to oxygen-containing compound [inference]

response to retinoic acid

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

regulation of cellular process [inference]

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

Displaying **all 5** entries
GO Term	Evidence Code	Reference
extracellular region	IEA	GO_REF
Golgi apparatus	ISO	GO_REF
Golgi apparatus	IBA	GO_REF
vesicle	IBA	GO_REF
Golgi cisterna membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

membrane [inference]

organelle membrane [inference]

Golgi cisterna membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle

intracellular membrane-bounded organelle [inference]

Golgi apparatus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
nucleotide binding	ISO	GO_REF
alpha-1,3-galactosyltransferase activity	IDA	PMID
antigen binding	ISO	GO_REF
glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase activity	ISS	GO_REF
glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase activity	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

glycosyltransferase activity [inference]

UDP-glycosyltransferase activity [inference]

acetylgalactosaminyltransferase activity [inference]

glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase activity

UDP-galactosyltransferase activity [inference]

hexosyltransferase activity [inference]

acetylgalactosaminyltransferase activity [inference]

glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase activity

galactosyltransferase activity [inference]

alpha-1,3-galactosyltransferase activity

UDP-galactosyltransferase activity [inference]

beta-1,3-galactosyltransferase activity [inference]

N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase activity

catalytic activity, acting on a protein [inference]

catalytic activity, acting on a glycoprotein [inference]

glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase activity

binding [inference]

antigen binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

manganese ion binding

heterocyclic compound binding [inference]

nucleotide binding

nucleoside phosphate binding [inference]

nucleotide binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKDLRFGRLKCYSLHLGILPLTVLVLVFFCFVCLSLRSQEWGHPGAVNRKAYPQPRVLTPTRTDVLVLTPWLAPIIWEGTFDIDTLNEQFRLRNTTIGLTVFAVKKYVVFLKLFLETAEQHFMVGHKVIYYVFTDRPADVPQVPLGAGRRLVVLTVRNYTRWQDVSMHRMEVISHFSEQRFRHEVDYLVCADVDMKFRDHVGVEILSALFGTLHPGFYRSRRESFTYERRPQSQAYIPWDQGDFYYMGAFFGGSVVEVHHLTKACHQAMVEDQANGIEAVWHDESHLNKYLLYHKPTKVLSPEYMWDQQLLGWPSIMKKLRYVAVPKNHQAIRN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
94	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
ABO blood group biosynthesis	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements