GlyCosmos Portal

Submissions

REST corepressor 1

Summary

UniProt ID: Q8CFE3
Gene Symbol: Rcor1 D12Wsu95e Kiaa0071
Gene ID: 217864
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q8CFE3
PubChem: Q8CFE3
O-GlcNAcAtlas: Q8CFE3
Re-Glyco: Q8CFE3

Annotation

Keyword: Chromatin regulator Coiled coil Isopeptide bond Nucleus Phosphoprotein Reference proteome Repeat Repressor Transcription regulation Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
chromatin organization
regulation of transcription by RNA polymerase II	IBA	GO_REF
negative regulation of gene expression	IDA	PMID
erythrocyte differentiation	IMP	PMID PMID
positive regulation of megakaryocyte differentiation	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

cellular developmental process [inference]

cell differentiation [inference]

myeloid cell differentiation [inference]

erythrocyte differentiation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

chromatin organization

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

myeloid cell differentiation [inference]

erythrocyte differentiation

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of megakaryocyte differentiation [inference]

positive regulation of megakaryocyte differentiation

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of developmental process [inference]

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of cell development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of megakaryocyte differentiation [inference]

positive regulation of megakaryocyte differentiation

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of megakaryocyte differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

negative regulation of gene expression

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

negative regulation of gene expression

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of cell development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of megakaryocyte differentiation [inference]

positive regulation of megakaryocyte differentiation

positive regulation of cellular process [inference]

positive regulation of cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of multicellular organismal process [inference]

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of megakaryocyte differentiation [inference]

positive regulation of megakaryocyte differentiation

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
histone deacetylase complex	IBA	GO_REF
nucleus	ISO	GO_REF
nucleus	IEA	GO_REF GO_REF
nucleoplasm	ISO	GO_REF
nucleoplasm	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

transcription regulator complex

transcription repressor complex

nuclear protein-containing complex [inference]

catalytic complex [inference]

histone deacetylase complex

transferase complex [inference]

methyltransferase complex [inference]

histone methyltransferase complex

DNA repair complex

cellular anatomical structure [inference]

nucleoplasm

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying **all 4** entries
GO Term	Evidence Code	Reference
chromatin binding	IDA	PMID
transcription corepressor activity	IDA	PMID
transcription corepressor activity	IBA	GO_REF
enzyme binding	IPI	PMID

GO Hierarchy

molecular function

binding [inference]

chromatin binding

protein binding [inference]

enzyme binding

transcription regulator activity [inference]

transcription coregulator activity [inference]

transcription corepressor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPAMVEKGPEVSGKRRGRNTAASAASAAASAASAAASAAASAGTASASAAAAASAAAAPNNGQNKSLAAAAPNGNSGSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAAVPDFDPAKLARRSQERDNLGMLVWSPNQSLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEETNGSNPVDIEIDPNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSIKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKDETNGPANQKPVKSPESSIKIPEEEDEAASVLDVRYASAS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites