GlyCosmos Portal

Submissions

Pseudokinase FAM20A

Summary

UniProt ID: Q8CID3
Gene Symbol: Fam20a
Gene ID: 208659
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0006677
PubChem: Q8CID3
Re-Glyco: Q8CID3

Annotation

Keyword: Biomineralization Disulfide bond Endoplasmic reticulum Glycoprotein Golgi apparatus Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
positive regulation of protein phosphorylation	ISO	GO_REF
positive regulation of protein phosphorylation	IDA	PMID
response to bacterium	IEP	PMID
biomineral tissue development	ISS	GO_REF
biomineral tissue development	ISO	GO_REF

GO Hierarchy

biological process

developmental process [inference]

anatomical structure development [inference]

animal gross anatomical part developmental process [inference]

tissue development [inference]

biomineral tissue development

tooth mineralization [inference]

enamel mineralization

tooth eruption

homeostatic process [inference]

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

monoatomic cation homeostasis [inference]

calcium ion homeostasis

inorganic ion homeostasis [inference]

calcium ion homeostasis

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to bacterium

response to stimulus [inference]

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

regulation of cellular process [inference]

regulation of metabolic process [inference]

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

regulation of phosphorylation [inference]

regulation of protein phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
cytoplasm	IDA	PMID
endoplasmic reticulum	IDA	PMID
endoplasmic reticulum	IEA	GO_REF
Golgi apparatus	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Displaying **all 4** entries
GO Term	Evidence Code	Reference
protein serine/threonine kinase activator activity	ISS	GO_REF
protein serine/threonine kinase activator activity	ISO	GO_REF
protein serine/threonine kinase activator activity	IBA	GO_REF
protein serine/threonine kinase activator activity	IEA	GO_REF

GO Hierarchy

molecular function

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme activator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein serine/threonine kinase activator activity

kinase regulator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein serine/threonine kinase activator activity

protein kinase regulator activity [inference]

protein kinase activator activity [inference]

protein serine/threonine kinase activator activity

molecular function activator activity [inference]

enzyme activator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein serine/threonine kinase activator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPGLRRDRLLALLLLGALFSADLYFHLWPQVQRQLRPGERPAACPCSGRAPSASLHSAAASRDLGTASHNFSGALPRVEHPSRGHPAPRSKLQALFAHSLYQVLEDPPLLGPEDWLLASQEALRYYRRKVARWNRRHKIYKEQFNLTSLDPPLQFRPEASWVQFHLGINSHGLYSRSSLAISKLLHDMRHFPTISADYSQDEKALLGACDCSQIVKPSGVHLKLVLRFSDFGKAMFKPMRQQREEETPEDFFYFIDFQRHNAEIAAFHLDRILDFRRVPPTVGRLVNVTKEILEVTKNEILQSVFFVSPANNVCFFAKCPYMCKTEYAVCGNPHLLEGSLSAFLPSLNLAPRLSVPNPWIRSYSLSGKEEWELNPLYCDTVKQIYPYNSSNRLLGIIDMAVFDFLIGNMDRHHYEMFTKFGDDGYLIHLDNARGFGRHSQDEISILAPLAQCCMIKRKTLLHLQLLAQADYRLSDVMRESLLEDQLSPVLTEPHLLALDRRLQIILKTVEDCIEAHGERRVIAEGSAQRSAPDSGQANLTS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	Source
70	N-linked (GlcNAc...) asparagine	GlycoProtDB UniProt
145	N-linked (GlcNAc...) asparagine	UniProt
287	N-linked (GlcNAc...) asparagine	UniProt
388	N-linked (GlcNAc...) asparagine	GlycoProtDB UniProt
538	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Post-translational protein phosphorylation	Mus musculus
Regulation of IGF Activity by IGFBP	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements