GlyCosmos Portal

Submissions

Amidophosphoribosyltransferase

Summary

UniProt ID: Q8CIH9
Gene Symbol: Ppat
Gene ID: 231327
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q8CIH9
PubChem: Q8CIH9
Re-Glyco: Q8CIH9

Annotation

Keyword: 4Fe-4S Acetylation Allosteric enzyme Glutamine amidotransferase Glycosyltransferase Magnesium Purine biosynthesis Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
purine nucleotide biosynthetic process
GMP biosynthetic process	IDA	PMID
'de novo' IMP biosynthetic process	IDA	PMID
'de novo' IMP biosynthetic process	IEA	GO_REF
L-glutamine catabolic process	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside monophosphate metabolic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine nucleoside monophosphate metabolic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine ribonucleoside monophosphate metabolic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside monophosphate metabolic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine nucleoside monophosphate metabolic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine ribonucleoside monophosphate metabolic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

catabolic process [inference]

amino acid catabolic process [inference]

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-glutamine catabolic process

small molecule catabolic process [inference]

organic acid catabolic process [inference]

carboxylic acid catabolic process [inference]

proteinogenic amino acid catabolic process [inference]

L-glutamine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-glutamine catabolic process

biosynthetic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleobase biosynthetic process [inference]

purine nucleobase biosynthetic process

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine nucleobase biosynthetic process

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside monophosphate metabolic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine nucleoside monophosphate metabolic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine ribonucleoside monophosphate metabolic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleobase metabolic process [inference]

purine nucleobase metabolic process [inference]

purine nucleobase biosynthetic process

nucleobase biosynthetic process [inference]

purine nucleobase biosynthetic process

amino acid metabolic process [inference]

amino acid catabolic process [inference]

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-glutamine catabolic process

proteinogenic amino acid metabolic process [inference]

L-glutamine metabolic process [inference]

L-glutamine catabolic process

proteinogenic amino acid catabolic process [inference]

L-glutamine catabolic process

alpha-amino acid metabolic process [inference]

L-amino acid metabolic process [inference]

L-glutamine metabolic process [inference]

L-glutamine catabolic process

L-amino acid catabolic process [inference]

L-glutamine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-glutamine catabolic process

small molecule metabolic process [inference]

organic acid metabolic process [inference]

organic acid catabolic process [inference]

carboxylic acid catabolic process [inference]

proteinogenic amino acid catabolic process [inference]

L-glutamine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-glutamine catabolic process

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

carboxylic acid catabolic process [inference]

proteinogenic amino acid catabolic process [inference]

L-glutamine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-glutamine catabolic process

proteinogenic amino acid metabolic process [inference]

L-glutamine metabolic process [inference]

L-glutamine catabolic process

proteinogenic amino acid catabolic process [inference]

L-glutamine catabolic process

alpha-amino acid metabolic process [inference]

L-amino acid metabolic process [inference]

L-glutamine metabolic process [inference]

L-glutamine catabolic process

L-amino acid catabolic process [inference]

L-glutamine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-glutamine catabolic process

small molecule catabolic process [inference]

organic acid catabolic process [inference]

carboxylic acid catabolic process [inference]

proteinogenic amino acid catabolic process [inference]

L-glutamine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-glutamine catabolic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside monophosphate metabolic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine nucleoside monophosphate metabolic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine ribonucleoside monophosphate metabolic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside monophosphate biosynthetic process [inference]

purine nucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleoside monophosphate biosynthetic process [inference]

purine ribonucleoside monophosphate biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

nucleobase metabolic process [inference]

purine nucleobase metabolic process [inference]

purine nucleobase biosynthetic process

nucleobase biosynthetic process [inference]

purine nucleobase biosynthetic process

purine-containing compound metabolic process [inference]

purine nucleobase metabolic process [inference]

purine nucleobase biosynthetic process

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

purine nucleobase biosynthetic process

carbohydrate derivative metabolic process [inference]

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

AMP metabolic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP metabolic process [inference]

GMP biosynthetic process

IMP metabolic process [inference]

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP metabolic process [inference]

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

AMP biosynthetic process [inference]

'de novo' AMP biosynthetic process

GMP biosynthetic process

IMP biosynthetic process [inference]

'de novo' IMP biosynthetic process

XMP biosynthetic process [inference]

'de novo' XMP biosynthetic process

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
amidophosphoribosyltransferase activity	ISS	GO_REF
amidophosphoribosyltransferase activity	ISO	GO_REF
amidophosphoribosyltransferase activity	IDA	PMID
amidophosphoribosyltransferase activity	IEA	GO_REF GO_REF GO_REF
identical protein binding	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

glycosyltransferase activity [inference]

pentosyltransferase activity [inference]

amidophosphoribosyltransferase activity

binding [inference]

protein binding [inference]

identical protein binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

metal cluster binding [inference]

iron-sulfur cluster binding [inference]

4 iron, 4 sulfur cluster binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MELEELGIREECGVFGCIASGDWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSAVPKFRVHKGMGLVNHVFTEDNLKKLYDSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVAHNGELVNAARLRKKLLRQGIGLSTSSDSEMITQLLAYTPPQEKDDAPDWVARIKNLMKEAPAAYSLVIMHRDFIYAVRDPYGNRPLCIGRLMPVSDVNDKEKKSSETEGWVVSSESCSFLSIGARYCHEVKPGEIVEISRHGIRTLDIIPRSNGDPVAFCIFEYVYFARPDSMFEDQMVYTVRYRCGQQLAIEAPVEADLVSTVPESATPAALGYATKCGLPYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLIDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPIKYPCFMGINIPTKEELIANKPEFDCLAEYLGANSVVYLSVEGLVSSVQQEIKFKKQKVKKHDIAIQENGNGLEYFEKTGHCTACLTGQYPVELEW

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
329				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Purine ribonucleoside monophosphate biosynthesis	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements