GlyCosmos Portal

Submissions

Long-chain-fatty-acid--CoA ligase 5

Summary

UniProt ID: Q8JZR0
Gene Symbol: Acsl5 Facl5
Gene ID: 433256
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q8JZR0
PubChem: Q8JZR0
RaftProt: Q8JZR0
Re-Glyco: Q8JZR0

Annotation

Keyword: ATP-binding Acetylation Cell membrane Endoplasmic reticulum Fatty acid metabolism Ligase Magnesium Mitochondrion outer membrane Reference proteome Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
long-chain fatty acid metabolic process	ISS	GO_REF
long-chain fatty acid metabolic process	ISO	GO_REF GO_REF
long-chain fatty acid metabolic process	IMP	PMID
long-chain fatty acid metabolic process	IEA	GO_REF
phospholipid biosynthetic process	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

sulfur compound metabolic process [inference]

acyl-CoA metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

sulfur compound biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

phospholipid metabolic process [inference]

phospholipid biosynthetic process

nucleoside phosphate metabolic process [inference]

acyl-CoA metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

nucleoside phosphate biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

organophosphate metabolic process [inference]

phospholipid metabolic process [inference]

phospholipid biosynthetic process

nucleoside phosphate metabolic process [inference]

acyl-CoA metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

nucleoside phosphate biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

organophosphate biosynthetic process [inference]

phospholipid biosynthetic process

nucleoside phosphate biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

biosynthetic process [inference]

lipid biosynthetic process [inference]

phospholipid biosynthetic process

fatty acid derivative biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

sulfur compound biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

purine-containing compound biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

organophosphate biosynthetic process [inference]

phospholipid biosynthetic process

nucleoside phosphate biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

acyl-CoA metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

nucleoside phosphate biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

lipid metabolic process [inference]

fatty acid metabolic process [inference]

long-chain fatty acid metabolic process

phospholipid metabolic process [inference]

phospholipid biosynthetic process

lipid biosynthetic process [inference]

phospholipid biosynthetic process

fatty acid derivative biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

fatty acid derivative metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

fatty acid derivative biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

small molecule metabolic process [inference]

organic acid metabolic process [inference]

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

monocarboxylic acid metabolic process [inference]

fatty acid metabolic process [inference]

long-chain fatty acid metabolic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

acyl-CoA metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

nucleoside phosphate biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

purine-containing compound metabolic process [inference]

acyl-CoA metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA metabolic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

purine-containing compound biosynthetic process [inference]

acyl-CoA biosynthetic process [inference]

fatty-acyl-CoA biosynthetic process [inference]

long-chain fatty-acyl-CoA biosynthetic process

localization [inference]

establishment of localization [inference]

transport [inference]

lipid transport [inference]

fatty acid transport

organic anion transport [inference]

carboxylic acid transport [inference]

monocarboxylic acid transport [inference]

fatty acid transport

organic acid transport [inference]

carboxylic acid transport [inference]

monocarboxylic acid transport [inference]

fatty acid transport

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of apoptotic signaling pathway [inference]

regulation of extrinsic apoptotic signaling pathway

regulation of localization [inference]

regulation of transport [inference]

regulation of lipid transport [inference]

positive regulation of lipid transport [inference]

positive regulation of fatty acid transport [inference]

positive regulation of long-chain fatty acid import into cell [inference]

positive regulation of long-chain fatty acid import across plasma membrane

regulation of fatty acid transport [inference]

regulation of long-chain fatty acid import into cell [inference]

regulation of long-chain fatty acid import across plasma membrane [inference]

positive regulation of long-chain fatty acid import across plasma membrane

positive regulation of long-chain fatty acid import into cell [inference]

positive regulation of long-chain fatty acid import across plasma membrane

positive regulation of fatty acid transport [inference]

positive regulation of long-chain fatty acid import into cell [inference]

positive regulation of long-chain fatty acid import across plasma membrane

regulation of organic acid transport [inference]

positive regulation of organic acid transport [inference]

positive regulation of fatty acid transport [inference]

positive regulation of long-chain fatty acid import into cell [inference]

positive regulation of long-chain fatty acid import across plasma membrane

regulation of fatty acid transport [inference]

regulation of long-chain fatty acid import into cell [inference]

regulation of long-chain fatty acid import across plasma membrane [inference]

positive regulation of long-chain fatty acid import across plasma membrane

positive regulation of long-chain fatty acid import into cell [inference]

positive regulation of long-chain fatty acid import across plasma membrane

positive regulation of fatty acid transport [inference]

positive regulation of long-chain fatty acid import into cell [inference]

positive regulation of long-chain fatty acid import across plasma membrane

regulation of transmembrane transport [inference]

regulation of long-chain fatty acid import across plasma membrane [inference]

positive regulation of long-chain fatty acid import across plasma membrane

positive regulation of transmembrane transport [inference]

positive regulation of long-chain fatty acid import across plasma membrane

positive regulation of transport [inference]

positive regulation of lipid transport [inference]

positive regulation of fatty acid transport [inference]

positive regulation of long-chain fatty acid import into cell [inference]

positive regulation of long-chain fatty acid import across plasma membrane

positive regulation of organic acid transport [inference]

positive regulation of fatty acid transport [inference]

positive regulation of long-chain fatty acid import into cell [inference]

positive regulation of long-chain fatty acid import across plasma membrane

positive regulation of transmembrane transport [inference]

positive regulation of long-chain fatty acid import across plasma membrane

regulation of lipid localization [inference]

regulation of lipid transport [inference]

positive regulation of lipid transport [inference]

positive regulation of fatty acid transport [inference]

positive regulation of long-chain fatty acid import into cell [inference]

positive regulation of long-chain fatty acid import across plasma membrane

regulation of fatty acid transport [inference]

regulation of long-chain fatty acid import into cell [inference]

regulation of long-chain fatty acid import across plasma membrane [inference]

positive regulation of long-chain fatty acid import across plasma membrane

positive regulation of long-chain fatty acid import into cell [inference]

positive regulation of long-chain fatty acid import across plasma membrane

positive regulation of fatty acid transport [inference]

positive regulation of long-chain fatty acid import into cell [inference]

positive regulation of long-chain fatty acid import across plasma membrane

positive regulation of lipid localization [inference]

positive regulation of lipid transport [inference]

positive regulation of fatty acid transport [inference]

positive regulation of long-chain fatty acid import into cell [inference]

positive regulation of long-chain fatty acid import across plasma membrane

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of catabolic process [inference]

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of triglyceride metabolic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of small molecule metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of transmembrane transport [inference]

positive regulation of long-chain fatty acid import across plasma membrane

positive regulation of transport [inference]

positive regulation of lipid transport [inference]

positive regulation of fatty acid transport [inference]

positive regulation of long-chain fatty acid import into cell [inference]

positive regulation of long-chain fatty acid import across plasma membrane

positive regulation of organic acid transport [inference]

positive regulation of fatty acid transport [inference]

positive regulation of long-chain fatty acid import into cell [inference]

positive regulation of long-chain fatty acid import across plasma membrane

positive regulation of transmembrane transport [inference]

positive regulation of long-chain fatty acid import across plasma membrane

positive regulation of lipid localization [inference]

positive regulation of lipid transport [inference]

positive regulation of fatty acid transport [inference]

positive regulation of long-chain fatty acid import into cell [inference]

positive regulation of long-chain fatty acid import across plasma membrane

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of apoptotic signaling pathway [inference]

regulation of extrinsic apoptotic signaling pathway

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of apoptotic signaling pathway [inference]

regulation of extrinsic apoptotic signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

regulation of lipid biosynthetic process [inference]

regulation of triglyceride biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of catabolic process [inference]

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of triglyceride metabolic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of small molecule metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

regulation of catabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

regulation of lipid catabolic process [inference]

regulation of fatty acid beta-oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

regulation of ketone metabolic process [inference]

regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

regulation of fatty acid oxidation [inference]

regulation of fatty acid beta-oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

regulation of small molecule metabolic process [inference]

regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

regulation of fatty acid oxidation [inference]

regulation of fatty acid beta-oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of small molecule metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

regulation of primary metabolic process [inference]

regulation of lipid metabolic process [inference]

regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

regulation of fatty acid oxidation [inference]

regulation of fatty acid beta-oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of triglyceride metabolic process [inference]

positive regulation of triglyceride biosynthetic process

regulation of lipid biosynthetic process [inference]

regulation of triglyceride biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

regulation of lipid catabolic process [inference]

regulation of fatty acid beta-oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

regulation of triglyceride metabolic process [inference]

regulation of triglyceride biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of triglyceride metabolic process [inference]

positive regulation of triglyceride biosynthetic process

regulation of transmembrane transport [inference]

regulation of long-chain fatty acid import across plasma membrane [inference]

positive regulation of long-chain fatty acid import across plasma membrane

positive regulation of transmembrane transport [inference]

positive regulation of long-chain fatty acid import across plasma membrane

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

regulation of apoptotic signaling pathway [inference]

regulation of extrinsic apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of catabolic process [inference]

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of lipid biosynthetic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of lipid catabolic process [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of triglyceride metabolic process [inference]

positive regulation of triglyceride biosynthetic process

positive regulation of small molecule metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid oxidation [inference]

positive regulation of fatty acid beta-oxidation

positive regulation of transmembrane transport [inference]

positive regulation of long-chain fatty acid import across plasma membrane

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
nucleoplasm	ISO	GO_REF
nucleolus	ISO	GO_REF
mitochondrion	ISS	GO_REF
mitochondrion	ISO	GO_REF
mitochondrion	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

nucleoplasm

membrane

plasma membrane

outer membrane [inference]

organelle outer membrane [inference]

mitochondrial outer membrane

organelle membrane [inference]

endoplasmic reticulum membrane

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

bounding membrane of organelle [inference]

organelle outer membrane [inference]

mitochondrial outer membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

membraneless organelle [inference]

intracellular membraneless organelle [inference]

nucleolus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular membraneless organelle [inference]

nucleolus

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
long-chain fatty acid-CoA ligase activity	ISS	GO_REF
long-chain fatty acid-CoA ligase activity	ISO	GO_REF GO_REF
long-chain fatty acid-CoA ligase activity	IMP	PMID
long-chain fatty acid-CoA ligase activity	IEA	GO_REF GO_REF GO_REF GO_REF GO_REF
ATP binding

GO Hierarchy

molecular function

catalytic activity [inference]

ligase activity [inference]

ligase activity, forming carbon-sulfur bonds [inference]

acid-thiol ligase activity [inference]

fatty acid ligase activity [inference]

fatty acid-CoA ligase activity [inference]

long-chain fatty acid-CoA ligase activity

CoA-ligase activity [inference]

fatty acid-CoA ligase activity [inference]

long-chain fatty acid-CoA ligase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

ATP-dependent activity [inference]

fatty acid ligase activity [inference]

fatty acid-CoA ligase activity [inference]

long-chain fatty acid-CoA ligase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLFIFNFLFSPLPTPALICLLTFGTAIFLWLINRPQPVLPLIDLDNQSVGIEGGARRGAFQKNNDLILYYFSDAKTLYENFQRGLAVSDNGPCLGYRKPNQPYKWISYKQVSDRAEYLGSCLLHKGYKSSQDQFVGIFAQNRPEWVISELACYTYSMVAVPLYDTLGTEAIIFVINRADIPVVICDTPQKATMLVENVEKGLTPGLKTIILMDPFDDDLMKRGEKCGVEMLSLHDAENIGKENFKKPVPPKPEDLSVICFTSGTTGDPKGAMLTHENVVSNMAAFLKFLEPIFQPTSDDVTISYLPLAHMFERLVQGILFSCGGKIGFFQGDIRLLPDDMKALKPTVFPTVPRLLNRVYDKVQNEAKTPLKKFLLNLAIISKFNEVKNGIIRRDSLWDKLVFSKIQGSLGGKVRLMITGAAPISTPVLTFFRAAMGCWVFEAYGQTECTGGCSITSPGDWTAGHVGTPVACNFVKLEDVADMNYFSVNNEGEICIKGNNVFKGYLKDPEKTQEVLDKDGWLHTGDIGRWLPNGTLKIVDRKKNIFKLAQGEYIAPEKIENVYSRSRPVLQVFVHGESLRSFLIGVVVPDPDSLPSFAAKIGVKGSFEELCKNQCVKEAILEDLQKIGKEGGLKSFEQVKSIFVHPEPFTIENGLLTPTLKAKRVELAKFFQTQIKSLYESIEE

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
14				GlyGen
350				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Synthesis of very long-chain fatty acyl-CoAs	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements