GlyCosmos Portal

Submissions

Protein lin-7 homolog A

Summary

UniProt ID: Q8JZS0
Gene Symbol: Lin7a Mals1 Veli1
Gene ID: 108030
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q8JZS0
O-GlcNAcAtlas: Q8JZS0
Re-Glyco: Q8JZS0

Annotation

Keyword: Cell membrane Exocytosis Postsynaptic cell membrane Protein transport Reference proteome Tight junction

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
exocytosis
neurotransmitter secretion	IGI	PMID
neurotransmitter secretion	IBA	GO_REF
regulation of synaptic assembly at neuromuscular junction	IBA	GO_REF
protein transport	NAS	PMID

GO Hierarchy

biological process

cellular process [inference]

vesicle-mediated transport [inference]

exocytosis

synaptic vesicle transport

export from cell [inference]

secretion by cell [inference]

exocytosis

signal release [inference]

signal release from synapse [inference]

neurotransmitter secretion

developmental process [inference]

anatomical structure development [inference]

inner ear development

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport

establishment of localization [inference]

transport [inference]

neurotransmitter transport [inference]

neurotransmitter secretion

protein transport

vesicle-mediated transport [inference]

exocytosis

secretion [inference]

secretion by cell [inference]

exocytosis

signal release [inference]

signal release from synapse [inference]

neurotransmitter secretion

synaptic vesicle transport

export from cell [inference]

secretion by cell [inference]

exocytosis

signal release [inference]

signal release from synapse [inference]

neurotransmitter secretion

establishment of protein localization [inference]

protein transport

establishment of localization in cell [inference]

neurotransmitter secretion

establishment of vesicle localization [inference]

synaptic vesicle transport

establishment of organelle localization [inference]

establishment of vesicle localization [inference]

synaptic vesicle transport

organelle localization [inference]

vesicle localization [inference]

establishment of vesicle localization [inference]

synaptic vesicle transport

synaptic vesicle localization [inference]

synaptic vesicle transport

establishment of organelle localization [inference]

establishment of vesicle localization [inference]

synaptic vesicle transport

biological regulation [inference]

regulation of biological process [inference]

regulation of growth [inference]

regulation of developmental growth [inference]

regulation of synaptic assembly at neuromuscular junction

regulation of developmental process [inference]

regulation of developmental growth [inference]

regulation of synaptic assembly at neuromuscular junction

regulation of cellular process [inference]

regulation of cellular component biogenesis [inference]

regulation of cell junction assembly [inference]

regulation of synapse assembly [inference]

regulation of synaptic assembly at neuromuscular junction

regulation of cellular component organization [inference]

regulation of synapse organization [inference]

regulation of synapse assembly [inference]

regulation of synaptic assembly at neuromuscular junction

regulation of neuromuscular junction development [inference]

regulation of synaptic assembly at neuromuscular junction

regulation of cell junction assembly [inference]

regulation of synapse assembly [inference]

regulation of synaptic assembly at neuromuscular junction

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
cell-cell junction	IBA	GO_REF
bicellular tight junction	IEA	GO_REF
membrane	NAS	PMID
membrane	IDA	PMID
basolateral plasma membrane	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

plasma membrane protein complex [inference]

MPP7-DLG1-LIN7 complex

cellular anatomical structure [inference]

membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

transport vesicle membrane

bounding membrane of organelle [inference]

transport vesicle membrane

plasma membrane region [inference]

basolateral plasma membrane

synaptic membrane [inference]

postsynaptic specialization membrane [inference]

postsynaptic density membrane

cell junction [inference]

synapse

anchoring junction [inference]

cell-cell junction

tight junction [inference]

bicellular tight junction

presynapse

Displaying **all 4** entries
GO Term	Evidence Code	Reference
PDZ domain binding	ISO	GO_REF
protein-macromolecule adaptor activity	IBA	GO_REF
L27 domain binding	ISO	GO_REF
L27 domain binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

protein domain specific binding [inference]

molecular adaptor activity [inference]

protein-macromolecule adaptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQQQQLLIQQQQQQQQQQPQQNHMS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites