GlyCosmos Portal

Submissions

C-type lectin domain family 4, member a3

Summary

UniProt ID: Q8JZX6
Gene Symbol: Clec4a3 Dcir3
Gene ID: 73149
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0006715
Re-Glyco: Q8JZX6

Annotation

Keyword: Adaptive immunity Calcium Cell membrane Disulfide bond Glycoprotein Innate immunity Lectin Metal-binding Proteomics identification Receptor Reference proteome Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of cytokine production	ISO	GO_REF
adaptive immune response
plasmacytoid dendritic cell antigen processing and presentation	ISO	GO_REF
proteolysis	IEA	GO_REF
negative regulation of tumor necrosis factor production	ISO	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

adaptive immune response

innate immune response [inference]

antifungal innate immune response

antigen processing and presentation [inference]

dendritic cell antigen processing and presentation [inference]

plasmacytoid dendritic cell antigen processing and presentation

antigen processing and presentation of exogenous antigen [inference]

antigen processing and presentation of exogenous peptide antigen [inference]

antigen processing and presentation of exogenous peptide antigen via MHC class I

antigen processing and presentation of peptide antigen [inference]

antigen processing and presentation of peptide antigen via MHC class I [inference]

antigen processing and presentation of exogenous peptide antigen via MHC class I

antigen processing and presentation of exogenous peptide antigen [inference]

antigen processing and presentation of exogenous peptide antigen via MHC class I

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

alpha-beta T cell activation [inference]

CD8-positive, alpha-beta T cell activation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

alpha-beta T cell activation [inference]

CD8-positive, alpha-beta T cell activation

metabolic process [inference]

macromolecule metabolic process [inference]

protein metabolic process [inference]

proteolysis

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

alpha-beta T cell activation [inference]

CD8-positive, alpha-beta T cell activation

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to fungus [inference]

defense response to fungus [inference]

antifungal innate immune response

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

antifungal innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to fungus [inference]

antifungal innate immune response

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

antifungal innate immune response

immune response [inference]

adaptive immune response

innate immune response [inference]

antifungal innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to fungus [inference]

defense response to fungus [inference]

antifungal innate immune response

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

antifungal innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to fungus [inference]

defense response to fungus [inference]

antifungal innate immune response

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

antifungal innate immune response

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

regulation of tumor necrosis factor superfamily cytokine production [inference]

regulation of tumor necrosis factor production [inference]

negative regulation of tumor necrosis factor production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

regulation of tumor necrosis factor superfamily cytokine production [inference]

regulation of tumor necrosis factor production [inference]

negative regulation of tumor necrosis factor production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

regulation of tumor necrosis factor superfamily cytokine production [inference]

regulation of tumor necrosis factor production [inference]

negative regulation of tumor necrosis factor production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production

negative regulation of tumor necrosis factor superfamily cytokine production [inference]

negative regulation of tumor necrosis factor production

Displaying 1 entry
GO Term	Evidence Code	Reference
external side of plasma membrane	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
aspartic-type endopeptidase activity	IEA	GO_REF
calcium ion binding	ISO	GO_REF
D-mannose binding	ISO	GO_REF
carbohydrate binding	ISO	GO_REF
carbohydrate binding	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

endopeptidase activity [inference]

aspartic-type endopeptidase activity

aspartic-type peptidase activity [inference]

aspartic-type endopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

endopeptidase activity [inference]

aspartic-type endopeptidase activity

aspartic-type peptidase activity [inference]

aspartic-type endopeptidase activity

binding [inference]

carbohydrate binding

monosaccharide binding [inference]

D-mannose binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

calcium ion binding

monosaccharide binding [inference]

D-mannose binding

molecular transducer activity [inference]

signaling receptor activity [inference]

pattern recognition receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MFSENIYVNTNFKNKVDSSDIDTDSWPAPQRKNTSQKSCHKFSKVLFTSLIIYFLLLTILFSGALITLFTKYSQLLEEKMIIKELNYTELECTKWASLLEDKVWSCCPKDWKPFGSYCYFTSTDLVASWNESKENCFHMGAHLVVIHSQEEQDFITGILDTGTAYFIGLSNPGDQQWQWIDQTPYDDNTTFWHKGEPSSDNEQCVIINHRQSTGWGWSDIPCSDKQNSICHVKKIYL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites