GlyCosmos Portal

Submissions

Arf-GAP domain and FG repeat-containing protein 1

Summary

UniProt ID: Q8K2K6
Gene Symbol: Agfg1 Hrb Rip
Gene ID: 15463
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q8K2K6
PubChem: Q8K2K6
The O-GlcNAc Database: Q8K2K6
O-GlcNAcAtlas: Q8K2K6
Re-Glyco: Q8K2K6

Annotation

Keyword: Alternative splicing Cytoplasmic vesicle DNA-binding Developmental protein Glycoprotein Nucleus Phosphoprotein Reference proteome Repeat Spermatogenesis Transport Zinc-finger

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
acrosome assembly	IMP	PMID PMID
acrosome assembly	IBA	GO_REF
spermatid nucleus differentiation	IMP	PMID
spermatid nucleus differentiation	IBA	GO_REF
intermediate filament organization	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

cellular process involved in reproduction in multicellular organism [inference]

acrosome assembly

intermediate filament-based process [inference]

intermediate filament cytoskeleton organization [inference]

intermediate filament organization

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

nucleus organization [inference]

spermatid nucleus differentiation

cytoskeleton organization [inference]

intermediate filament cytoskeleton organization [inference]

intermediate filament organization

vesicle organization [inference]

secretory granule organization [inference]

acrosome assembly

organelle assembly [inference]

acrosome assembly

cellular component assembly [inference]

cellular component assembly involved in morphogenesis [inference]

acrosome assembly

organelle assembly [inference]

acrosome assembly

supramolecular fiber organization [inference]

intermediate filament organization

reproductive process [inference]

developmental process involved in reproduction [inference]

acrosome assembly

multicellular organismal reproductive process [inference]

cellular process involved in reproduction in multicellular organism [inference]

acrosome assembly

developmental process [inference]

developmental process involved in reproduction [inference]

acrosome assembly

anatomical structure formation involved in morphogenesis [inference]

cellular component assembly involved in morphogenesis [inference]

acrosome assembly

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	ISO	GO_REF
nucleus	IEA	GO_REF
cytoplasm	IBA	GO_REF
cytoplasm	IEA	GO_REF
cytoplasmic vesicle	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle

intracellular membrane-bounded organelle [inference]

nucleus

intracellular vesicle [inference]

cytoplasmic vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular vesicle [inference]

cytoplasmic vesicle

cell body [inference]

neuronal cell body

Displaying **all 3** entries
GO Term	Evidence Code	Reference
DNA binding
GTPase activator activity	IEA	GO_REF
zinc ion binding

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

DNA binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme activator activity [inference]

GTPase activator activity

nucleoside-triphosphatase regulator activity [inference]

GTPase regulator activity [inference]

GTPase activator activity

molecular function activator activity [inference]

enzyme activator activity [inference]

GTPase activator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGESAPALHLNKGTPSQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSGSSNFGGFPTASHSSFQPQTTGGSAGSVNANFAHFDNFPKSSSADFGTFSTSQSHQTASTVSKVSTNKAGLQTADKYAALANLDNIFSAGQGGDQGSGFGTTGKAPVGSVVSVPSHSSASSDKYAALAELDSVFSSAATSSNAYTPTSNASSSVFGTVPVGASAQTQPASSGPAPFGATPSTNPFVAATGPSAASSTNPFQTNARGATAATFGTASMSMPAGFGTPAQYSLPTSFSGSFQQPAFPAQAAFPQQTAFSQQPNGAGFATFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQLPTGSSSTNPFL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying entries **1 - 10** of 16 in total

1

2

Next ›

Last »
Position	PubMed ID	GlyTouCan ID	Source
138	21606357 22517741 22645316 30059200 33300544 34678516 35822049 36852467 40021952 40885482	G49108TO	GlyGen The O-GlcNAc Database
146	21606357 22517741 22645316 30059200 33300544 34678516 35822049 36852467 40021952 40885482	G49108TO	GlyGen The O-GlcNAc Database
291	21606357 22517741 22645316 30059200 33300544 34678516 35822049 36852467 40021952 40885482	G49108TO	GlyGen The O-GlcNAc Database
292	21606357 22517741 22645316 30059200 33300544 34678516 35822049 36852467 40021952 40885482	G49108TO	GlyGen The O-GlcNAc Database
293	21606357 22517741 22645316 30059200 33300544 34678516 35822049 36852467 40021952 40885482	G49108TO	The O-GlcNAc Database
298	21606357 22517741 22645316 30059200 33300544 34678516 35822049 36852467 40021952 40885482	G49108TO	GlyGen The O-GlcNAc Database
300	21606357 22517741 22645316 30059200 33300544 34678516 35822049 36852467 40021952 40885482	G49108TO	GlyGen The O-GlcNAc Database
301	21606357 22517741 22645316 30059200 33300544 34678516 35822049 36852467 40021952 40885482	G49108TO	The O-GlcNAc Database
302	21606357 22517741 22645316 30059200 33300544 34678516 35822049 36852467 40021952 40885482	G49108TO	GlyGen The O-GlcNAc Database
304	21606357 22517741 22645316 30059200 33300544 34678516 35822049 36852467 40021952 40885482	G49108TO	GlyGen The O-GlcNAc Database