GlyCosmos Portal

Submissions

Proton-coupled amino acid transporter 1

Summary

UniProt ID: Q8K4D3
Gene Symbol: Pat1 Slc36a1
Gene ID: 215335
Organism: Mus musculus (house mouse)

External Links

PubChem: Q8K4D3
Re-Glyco: Q8K4D3

Annotation

Keyword: Amino-acid transport Cell membrane Disulfide bond Glycoprotein Lysosome Reference proteome Symport Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
taurine transmembrane transport	ISO	GO_REF
taurine transmembrane transport	IEA	GO_REF
neutral amino acid transport	ISO	GO_REF
neutral amino acid transport	IEA	GO_REF
L-alanine transport	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

transmembrane transport [inference]

amino acid transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

proton transmembrane transport

alkanesulfonate transmembrane transport [inference]

taurine transmembrane transport

import across plasma membrane [inference]

amino acid import across plasma membrane

carboxylic acid transmembrane transport [inference]

proline transmembrane transport

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport [inference]

monoatomic cation transmembrane transport [inference]

proton transmembrane transport

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

proton transmembrane transport

amino acid transport [inference]

amino acid transmembrane transport [inference]

neutral amino acid transport

alanine transport

L-alanine transport

L-amino acid transport [inference]

organic cation transport [inference]

alanine transport

L-alanine transport

organic anion transport [inference]

alkanesulfonate transmembrane transport [inference]

taurine transmembrane transport

carboxylic acid transport [inference]

L-amino acid transport [inference]

glycine transport

alanine transport

L-alanine transport

carboxylic acid transmembrane transport [inference]

proline transmembrane transport

organic acid transport [inference]

alkanesulfonate transmembrane transport [inference]

taurine transmembrane transport

carboxylic acid transport [inference]

L-amino acid transport [inference]

glycine transport

alanine transport

L-alanine transport

carboxylic acid transmembrane transport [inference]

proline transmembrane transport

transmembrane transport [inference]

amino acid transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

proton transmembrane transport

alkanesulfonate transmembrane transport [inference]

taurine transmembrane transport

import across plasma membrane [inference]

amino acid import across plasma membrane

carboxylic acid transmembrane transport [inference]

proline transmembrane transport

nitrogen compound transport [inference]

taurine transmembrane transport

L-amino acid transport [inference]

glycine transport

alanine transport

L-alanine transport

proline transmembrane transport

sulfur compound transport [inference]

alkanesulfonate transmembrane transport [inference]

taurine transmembrane transport

import into cell [inference]

import across plasma membrane [inference]

amino acid import across plasma membrane

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
lysosome	ISO	PMID GO_REF
lysosome	IEA	GO_REF
lysosomal membrane	ISS	GO_REF
lysosomal membrane	ISO	GO_REF
lysosomal membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle membrane [inference]

bounding membrane of organelle [inference]

vacuolar membrane

lytic vacuole membrane [inference]

lysosomal membrane

plasma membrane region [inference]

apical plasma membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

endoplasmic reticulum

Displaying entries **1 - 5** of 20 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
amino acid:proton symporter activity	ISO	GO_REF GO_REF
amino acid:proton symporter activity	IDA	PMID
amino acid:proton symporter activity	IBA	GO_REF
amino acid:proton symporter activity	IEA	GO_REF
proline:proton symporter activity	ISO	GO_REF GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic cation transmembrane transporter activity [inference]

proton transmembrane transporter activity

solute:proton symporter activity [inference]

amino acid:proton symporter activity

proline:proton symporter activity

solute:monoatomic cation symporter activity [inference]

amino acid:monoatomic cation symporter activity [inference]

amino acid:proton symporter activity

proline:proton symporter activity

solute:proton symporter activity [inference]

amino acid:proton symporter activity

proline:proton symporter activity

amino acid transmembrane transporter activity [inference]

amino acid:monoatomic cation symporter activity [inference]

amino acid:proton symporter activity

proline:proton symporter activity

neutral L-amino acid transmembrane transporter activity

alanine transmembrane transporter activity

L-alanine transmembrane transporter activity

L-amino acid transmembrane transporter activity [inference]

active transmembrane transporter activity [inference]

secondary active transmembrane transporter activity [inference]

symporter activity [inference]

solute:monoatomic cation symporter activity [inference]

amino acid:monoatomic cation symporter activity [inference]

amino acid:proton symporter activity

proline:proton symporter activity

solute:proton symporter activity [inference]

amino acid:proton symporter activity

proline:proton symporter activity

primary active transmembrane transporter activity [inference]

ATPase-coupled transmembrane transporter activity [inference]

ABC-type transporter activity [inference]

ABC-type alkanesulfonate transporter transporter activity [inference]

ABC-type taurine transporter transporter activity

carboxylic acid transmembrane transporter activity [inference]

proline:proton symporter activity

L-amino acid transmembrane transporter activity [inference]

glycine transmembrane transporter activity

alanine transmembrane transporter activity

L-alanine transmembrane transporter activity

sulfur compound transmembrane transporter activity [inference]

taurine transmembrane transporter activity [inference]

ABC-type taurine transporter transporter activity

ABC-type alkanesulfonate transporter transporter activity [inference]

ABC-type taurine transporter transporter activity

ATP-dependent activity [inference]

ATPase-coupled transmembrane transporter activity [inference]

ABC-type transporter activity [inference]

ABC-type alkanesulfonate transporter transporter activity [inference]

ABC-type taurine transporter transporter activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSTQRLRNEDYHDYSSTDVSPEESPSEGLGSFSPGSYQRLGENSSMTWFQTLIHLLKGNIGTGLLGLPLAVKNAGLLLGPLSLLVIGIVAVHCMGILVKCAHHLCRRLNKPFLDYGDTVMYGLECSPSTWVRNHSHWGRRIVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTTNCNNNVTVIPTPTMDSRLYMLSFLPFLVLLSFIRNLRVLSIFSLLANISMFVSLIMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFAFEGIGVVLPLENKMKDSQKFPLILYLGMAIITVLYISLGSLGYLQFGANIKGSITLNLPNCWLYQSVKLLYSIGIFFTYALQFYVAAEIIIPAIVSRVPEHFELMVDLCVRTAMVCVTCVLAILIPRLDLVISLVGSVSSSALALIIPPLLEVVTYYGEGISPLTVTKDALISILGFVGFVVGTYESLCELIQPSHSDSSTNSTSAFI

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
173	N-linked (GlcNAc...) asparagine	UniProt
182	N-linked (GlcNAc...) asparagine	UniProt
469	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Amino acid transport across the plasma membrane	Mus musculus
Proton-coupled neutral amino acid transporters	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements