GlyCosmos Portal

Submissions

V-type proton ATPase subunit e 2

Summary

UniProt ID

Q8NHE4

Gene Symbol

ATP6V0E2
ATP6V0E2L
C7orf32

Gene ID

[155066]

Organism

Homo sapiens (human)

External Links

GlyGen: Q8NHE4
The Human Metabolome Database: HMDBP09532
The O-GlcNAc Database: Q8NHE4
O-GlcNAcAtlas: Q8NHE4
Re-Glyco: Q8NHE4

Annotation

Keyword: Alternative splicing Cytoplasmic vesicle Glycoprotein Hydrogen ion transport Proteomics identification Reference proteome Synapse Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
vacuolar acidification	ISS	GO_REF
regulation of macroautophagy	NAS	PMID
transmembrane transport
proton transmembrane transport	IGI	PMID
proton transmembrane transport	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

transmembrane transport

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

proton transmembrane transport

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

regulation of intracellular pH [inference]

intracellular pH reduction [inference]

vacuolar acidification

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

regulation of intracellular pH [inference]

intracellular pH reduction [inference]

vacuolar acidification

monoatomic cation homeostasis [inference]

regulation of pH [inference]

regulation of intracellular pH [inference]

intracellular pH reduction [inference]

vacuolar acidification

intracellular monoatomic cation homeostasis [inference]

regulation of intracellular pH [inference]

intracellular pH reduction [inference]

vacuolar acidification

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

regulation of intracellular pH [inference]

intracellular pH reduction [inference]

vacuolar acidification

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport [inference]

monoatomic cation transmembrane transport [inference]

proton transmembrane transport

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

proton transmembrane transport

transmembrane transport

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

proton transmembrane transport

biological regulation [inference]

regulation of pH [inference]

regulation of intracellular pH [inference]

intracellular pH reduction [inference]

vacuolar acidification

regulation of biological process [inference]

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of catabolic process [inference]

regulation of autophagy [inference]

regulation of macroautophagy

regulation of biological quality [inference]

regulation of intracellular pH [inference]

intracellular pH reduction [inference]

vacuolar acidification

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
vacuolar proton-transporting V-type ATPase, V0 domain	ISS	GO_REF
vacuolar proton-transporting V-type ATPase, V0 domain	IBA	GO_REF
lysosomal membrane	TAS	Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome
endosome membrane	TAS	Reactome Reactome Reactome
membrane	NAS	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

proton-transporting two-sector ATPase complex, proton-transporting domain [inference]

proton-transporting V-type ATPase, V0 domain [inference]

vacuolar proton-transporting V-type ATPase, V0 domain

cellular anatomical structure [inference]

membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane

transport vesicle membrane [inference]

exocytic vesicle membrane [inference]

synaptic vesicle membrane

coated vesicle membrane [inference]

clathrin-coated vesicle membrane

endocytic vesicle membrane [inference]

phagocytic vesicle membrane

bounding membrane of organelle [inference]

vacuolar membrane [inference]

lytic vacuole membrane [inference]

lysosomal membrane

endosome membrane

transport vesicle membrane [inference]

exocytic vesicle membrane [inference]

synaptic vesicle membrane

coated vesicle membrane [inference]

clathrin-coated vesicle membrane

endocytic vesicle membrane [inference]

phagocytic vesicle membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
ATPase-coupled ion transmembrane transporter activity	ISS	GO_REF
proton-transporting ATPase activity, rotational mechanism	IGI	PMID
proton-transporting ATPase activity, rotational mechanism	IBA	GO_REF
proton-transporting ATPase activity, rotational mechanism	IEA	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic cation transmembrane transporter activity [inference]

proton transmembrane transporter activity [inference]

proton-transporting ATPase activity, rotational mechanism

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

proton-transporting ATPase activity, rotational mechanism

active monoatomic ion transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

proton-transporting ATPase activity, rotational mechanism

active transmembrane transporter activity [inference]

primary active transmembrane transporter activity [inference]

active monoatomic ion transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

proton-transporting ATPase activity, rotational mechanism

ATPase-coupled transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

proton-transporting ATPase activity, rotational mechanism

ATPase-coupled ion transmembrane transporter activity

ATPase activity, coupled to transmembrane movement of ions, rotational mechanism [inference]

proton-transporting ATPase activity, rotational mechanism

ATP-dependent activity [inference]

ATPase-coupled transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

proton-transporting ATPase activity, rotational mechanism

ATPase-coupled ion transmembrane transporter activity

ATPase activity, coupled to transmembrane movement of ions, rotational mechanism [inference]

proton-transporting ATPase activity, rotational mechanism

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MTAHSFALPVIIFTTFWGLVGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETIWYVRFLWE

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
70	N-linked (GlcNAc...) asparagine	37074911	G80920RR G41247ZX	UniProt GlyGen
72		35289036	G49108TO	GlyGen The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 5** entries
Pathway Name	Organism
Amino acids regulate mTORC1	Homo sapiens
Insulin receptor recycling	Homo sapiens
Ion channel transport	Homo sapiens
ROS and RNS production in phagocytes	Homo sapiens
Transferrin endocytosis and recycling	Homo sapiens