GlyCosmos Portal

Submissions

Interleukin-17 receptor D

Summary

UniProt ID: Q8QHJ9
Gene Symbol: il17rd cb208 sef
Gene ID
Organism: Danio rerio (zebrafish)

External Links

PubChem: Q8QHJ9
Re-Glyco: Q8QHJ9

Annotation

Keyword: Glycoprotein Receptor Reference proteome Signal Transmembrane helix

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
dorsal/ventral pattern formation	IMP	PMID
negative regulation of fibroblast growth factor receptor signaling pathway	IMP	PMID
negative regulation of MAPK cascade	IMP	PMID

GO Hierarchy

biological process

multicellular organismal process [inference]

pattern specification process [inference]

regionalization [inference]

dorsal/ventral pattern formation

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of fibroblast growth factor receptor signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

regulation of fibroblast growth factor receptor signaling pathway [inference]

negative regulation of fibroblast growth factor receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

negative regulation of MAPK cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of fibroblast growth factor receptor signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of fibroblast growth factor receptor signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of fibroblast growth factor receptor signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of fibroblast growth factor receptor signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of fibroblast growth factor receptor signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of fibroblast growth factor receptor signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

regulation of fibroblast growth factor receptor signaling pathway [inference]

negative regulation of fibroblast growth factor receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

negative regulation of MAPK cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of fibroblast growth factor receptor signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of fibroblast growth factor receptor signaling pathway

regulation of cellular response to growth factor stimulus [inference]

regulation of fibroblast growth factor receptor signaling pathway [inference]

negative regulation of fibroblast growth factor receptor signaling pathway

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of fibroblast growth factor receptor signaling pathway

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of fibroblast growth factor receptor signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

regulation of fibroblast growth factor receptor signaling pathway [inference]

negative regulation of fibroblast growth factor receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

negative regulation of MAPK cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of fibroblast growth factor receptor signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of fibroblast growth factor receptor signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

Displaying **all 2** entries
GO Term	Evidence Code	Reference
membrane	ISS	PMID
membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

Displaying **all 2** entries
GO Term	Evidence Code	Reference
interleukin-17 receptor activity	IBA	GO_REF
interleukin-17 receptor activity	IEA	GO_REF

GO Hierarchy

molecular function

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

cytokine receptor activity [inference]

interleukin-17 receptor activity

immune receptor activity [inference]

cytokine receptor activity [inference]

interleukin-17 receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAGSRRLAHFFMASCLFLCYTASVNGGKRGNSDKCSYKQGTQTSSMDEGARKLGVTFRYDNCSVNWSPLGKHAIHEVNNISFSHLSCDSQAAVVVHWMASPLGIEHVKGFRVYLEDKNPERKQCQHLILKDPRQLNFSYKTIRMSSQPFSSLAFETDYMVRIVPFPTFLNDSFFPPSFLRTNSCEVLLGPDNLVCKPFWKPKMLNVSQLGSNLHVVFDHAPSTFGFSIYYLYYKLRQEGPFRLKRCKPEQNGPKTTCVLQDVTPGTYAIELRDDSNNTRRQTQYHVSQVHSPWAGPIRAMAITVPLVIMSAFATLFTVMCRKKQQENIYSHLDEESSESSSQTTALSADRPWPRPKIFICYSSRDGAKHLAVIQSFAFFLQDFCGCEVSLDLWEHLEICKEGQMSWLSRRIDEAHFIITVCSKGLKHFVEKRHRKGKATSKEKNREPSASDSSSSSRDLFIVASAIISEKLKEVHQKSSDLSRFMSVYFDYSHETDVPTSLSLAPKFKLMDQLPQLFARLHSRQLSLTDREPQPPNVSKRNYFCSKSGRSLYVAIYNMHQHVTQEPDWLEKELMPPPLPNKRTIPEKVDSGLVLNEVKLKHGSESECPPVRSNVLILPQTPQVGVSLSLSREDLGEGSSSQDAGSCRPVLHTDGSASPPEMPRDSGIYDSSVPSSELSIPLMDGLSPDHADNSSLADSVSSSSGLGDEEPPAVSSLHCTAHTICKADLHHQHLHPSEGLIAAAST

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	Source
61	N-linked (GlcNAc...) asparagine	UniProt
79	N-linked (GlcNAc...) asparagine	UniProt
136	N-linked (GlcNAc...) asparagine	UniProt
170	N-linked (GlcNAc...) asparagine	UniProt
205	N-linked (GlcNAc...) asparagine	UniProt
276	N-linked (GlcNAc...) asparagine	UniProt