GlyCosmos Portal

Submissions

Inactive ribonuclease-like protein 10

Summary

UniProt ID

Q8SPJ0

Gene Symbol

RNASE10

Gene ID

396701

Organism

Sus scrofa (pig)

External Links

GlyGen: Q8SPJ0
PubChem: Q8SPJ0
Re-Glyco: Q8SPJ0

Annotation

Keyword: Cell adhesion Direct protein sequencing Fertilization Glycoprotein Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
single fertilization
positive regulation of cell-cell adhesion	ISS	GO_REF
heterotypic cell-cell adhesion	ISS	GO_REF
defense response to Gram-positive bacterium	IBA	GO_REF
regulation of fertilization	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell adhesion [inference]

cell-cell adhesion [inference]

heterotypic cell-cell adhesion

reproductive process [inference]

fertilization [inference]

single fertilization

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to Gram-positive bacterium

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to bacterium [inference]

defense response to Gram-positive bacterium

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to Gram-positive bacterium

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to Gram-positive bacterium

biological regulation [inference]

regulation of biological process [inference]

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cilium-dependent cell motility [inference]

positive regulation of flagellated sperm motility

regulation of cell motility [inference]

regulation of cilium-dependent cell motility [inference]

regulation of cilium movement involved in cell motility [inference]

regulation of flagellated sperm motility [inference]

positive regulation of flagellated sperm motility

positive regulation of cilium-dependent cell motility [inference]

positive regulation of flagellated sperm motility

positive regulation of cell motility [inference]

positive regulation of cilium-dependent cell motility [inference]

positive regulation of flagellated sperm motility

positive regulation of biological process [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cilium-dependent cell motility [inference]

positive regulation of flagellated sperm motility

positive regulation of cellular process [inference]

positive regulation of cilium movement [inference]

positive regulation of flagellated sperm motility

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion

positive regulation of cell motility [inference]

positive regulation of cilium-dependent cell motility [inference]

positive regulation of flagellated sperm motility

positive regulation of reproductive process [inference]

positive regulation of flagellated sperm motility

regulation of cellular process [inference]

regulation of cell adhesion [inference]

regulation of cell-cell adhesion [inference]

positive regulation of cell-cell adhesion

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion

regulation of microtubule-based process [inference]

regulation of microtubule-based movement [inference]

regulation of cilium movement [inference]

positive regulation of cilium movement [inference]

positive regulation of flagellated sperm motility

regulation of cilium movement involved in cell motility [inference]

regulation of flagellated sperm motility [inference]

positive regulation of flagellated sperm motility

positive regulation of cellular process [inference]

positive regulation of cilium movement [inference]

positive regulation of flagellated sperm motility

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion

positive regulation of cell motility [inference]

positive regulation of cilium-dependent cell motility [inference]

positive regulation of flagellated sperm motility

regulation of cell motility [inference]

regulation of cilium-dependent cell motility [inference]

regulation of cilium movement involved in cell motility [inference]

regulation of flagellated sperm motility [inference]

positive regulation of flagellated sperm motility

positive regulation of cilium-dependent cell motility [inference]

positive regulation of flagellated sperm motility

positive regulation of cell motility [inference]

positive regulation of cilium-dependent cell motility [inference]

positive regulation of flagellated sperm motility

regulation of reproductive process [inference]

regulation of fertilization

regulation of flagellated sperm motility [inference]

positive regulation of flagellated sperm motility

positive regulation of reproductive process [inference]

positive regulation of flagellated sperm motility

Displaying 1 entry
GO Term	Evidence Code	Reference
extracellular region	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

Displaying 1 entry
GO Term	Evidence Code	Reference
nucleic acid binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKLTLVQFFFMMLLLLLGLGVGLGLGLQMAAAVLEESDQLLSEFQSSDSQDKTQATKKGAGTRTMETLLLSDNVVMQPEETILSEDEVGGNKMLRAQAFSQSYPNYLRSDLMDRECNTLMAKKMKPYNHTCISQYIFIHEEPDEIKAVCKSPPVACELKGGKCHKSARPFDLTFCKLSKPGQVTPHCNYVTFLLEKHILISCNDMKVQVMSGS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites