GlyCosmos Portal

Submissions

Haptoglobin [Cleaved into: Haptoglobin alpha chain; Haptoglobin beta chain]

Summary

UniProt ID: Q8SPS7
Gene Symbol: HP
Gene ID: 397061
Organism: Sus scrofa (pig)

External Links

GlyGen: Q8SPS7
PubChem: Q8SPS7
Re-Glyco: Q8SPS7

Annotation

Keyword: 3D-structure Acute phase Antibiotic Antioxidant Disulfide bond Glycoprotein Hemoglobin-binding Immunity Reference proteome Secreted Serine protease homolog Signal Sushi

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
immune system process
acute-phase response
zymogen activation	IBA	GO_REF
defense response to bacterium

GO Hierarchy

biological process

immune system process

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

protein metabolic process [inference]

proteolysis [inference]

protein processing [inference]

zymogen activation

protein maturation [inference]

protein processing [inference]

zymogen activation

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis [inference]

protein processing [inference]

zymogen activation

protein maturation [inference]

protein processing [inference]

zymogen activation

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response [inference]

acute inflammatory response [inference]

acute-phase response

defense response to bacterium

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium

Displaying **all 2** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
blood microparticle	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

blood microparticle

Displaying **all 3** entries
GO Term	Evidence Code	Reference
serine-type endopeptidase activity	IBA	GO_REF
antioxidant activity
hemoglobin binding	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

endopeptidase activity [inference]

serine-type endopeptidase activity

serine-type peptidase activity [inference]

serine-type endopeptidase activity

serine hydrolase activity [inference]

serine-type peptidase activity [inference]

serine-type endopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

endopeptidase activity [inference]

serine-type endopeptidase activity

serine-type peptidase activity [inference]

serine-type endopeptidase activity

binding [inference]

protein binding [inference]

hemoglobin binding

antioxidant activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MRALGAVVALLLCGQLFAAETGNEATDATDDSCPKPPEIPKGYVEHMVRYHCQTYYKLRTAGDGVYTLDSNKQWTNKVTGEKLPECEAVCGKPKNPVDQVQRIMGGSLDAKGSFPWQAKMISHHNLTSGATLINEQWLLTTAKNLRLGHKNDTKAKDIAPTLRLYVGKKQEVEIEKVIFHPDNSTVDIGLIKLKQKVPVNERVMPICLPSKDYVNVGLVGYVSGWGRNANLNFTEHLKYVMLPVADQEKCVQYYEGSTVPEKKTPKSPVGVQPILNEHTFCAGLSKYQEDTCYGDAGSAFAVHDKDDDTWYAAGILSFDKSCRTAEYGVYVRVTSILDWIQTTIADN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	Source
125	N-linked (GlcNAc...) asparagine	22922649	UniProt GlyGen
151	N-linked (GlcNAc...) asparagine	22922649	UniProt GlyGen
183	N-linked (GlcNAc...) asparagine	22922649	UniProt GlyGen
232	N-linked (GlcNAc...) asparagine	22922649	UniProt GlyGen