GlyCosmos Portal

Submissions

Osteoclast-associated immunoglobulin-like receptor

Summary

UniProt ID: Q8VBT3
Gene Symbol: Oscar
Gene ID: 232790
Organism: Mus musculus (house mouse)

External Links

PubChem: Q8VBT3
Re-Glyco: Q8VBT3

Annotation

Keyword: Alternative splicing Cell membrane Disulfide bond Glycoprotein Immunoglobulin domain Receptor Reference proteome Repeat Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
immune response-regulating signaling pathway
osteoclast differentiation	ISO	PMID
osteoclast differentiation	IDA	PMID
osteoclast differentiation	IMP	PMID
osteoclast differentiation	IGI	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

Fc receptor signaling pathway [inference]

Fc-gamma receptor signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

Fc receptor signaling pathway [inference]

Fc-gamma receptor signaling pathway

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

myeloid leukocyte differentiation [inference]

osteoclast differentiation

multinuclear osteoclast differentiation

myeloid cell differentiation [inference]

myeloid leukocyte differentiation [inference]

osteoclast differentiation

multinuclear osteoclast differentiation

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

myeloid leukocyte differentiation [inference]

osteoclast differentiation

multinuclear osteoclast differentiation

myeloid cell differentiation [inference]

myeloid leukocyte differentiation [inference]

osteoclast differentiation

multinuclear osteoclast differentiation

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

regulation of immune response [inference]

immune response-regulating signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

Fc receptor signaling pathway [inference]

Fc-gamma receptor signaling pathway

positive regulation of biological process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of bone resorption

regulation of response to stimulus [inference]

regulation of immune response [inference]

immune response-regulating signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

Fc receptor signaling pathway [inference]

Fc-gamma receptor signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

Fc receptor signaling pathway [inference]

Fc-gamma receptor signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

Fc receptor signaling pathway [inference]

Fc-gamma receptor signaling pathway

regulation of multicellular organismal process [inference]

regulation of tissue remodeling [inference]

regulation of bone remodeling [inference]

regulation of bone resorption [inference]

positive regulation of bone resorption

positive regulation of multicellular organismal process [inference]

positive regulation of bone resorption

Displaying **all 3** entries
GO Term	Evidence Code	Reference
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF
cell surface	IDA	PMID PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell surface

membrane [inference]

plasma membrane

Displaying **all 3** entries
GO Term	Evidence Code	Reference
collagen receptor activity	ISO	PMID
collagen receptor activity	IMP	PMID
collagen receptor activity	IBA	GO_REF

GO Hierarchy

molecular function

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

collagen receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVLSLILQLSTLWPACRADFTPTAPLASYPQPWLGAHPAAVVTPGINVTLTCRAPQSAWRFALFKSGLVTPLLLRDVSVELAEFFLEEVTPAQGGSYHCRYRKTDWGPGVWSQPSNVLELLVTDQLPRPSLVALPGPVVAPGANVSLRCAGRIPGMSFALYRVGVATPLQYIDSVQPWADFLLIGTHTPGTYCCYYHTPSAPYVLSQRSQPLVISFEGSGSLDYTQGNLIRLGLAGMVLICLGIIVTCDWHSRSSAFDGLLPQQN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
47	N-linked (GlcNAc...) asparagine			UniProt
144	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Neutrophil degranulation	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements