GlyCosmos Portal

Submissions

3-ketoacyl-CoA thiolase B, peroxisomal

Summary

UniProt ID: Q8VCH0
Gene Symbol: Acaa1b Acaa1
Gene ID: 235674
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q8VCH0
PubChem: Q8VCH0
Re-Glyco: Q8VCH0

Annotation

Keyword: Acetylation Acyltransferase Fatty acid metabolism Peroxisome Reference proteome Transit peptide

Gene Ontology (GO)

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
very long-chain fatty acid metabolic process	ISO	GO_REF
fatty acid biosynthetic process	IGI	PMID
fatty acid beta-oxidation	ISO	GO_REF
fatty acid beta-oxidation	IBA	GO_REF
unsaturated fatty acid biosynthetic process

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

xenobiotic metabolic process [inference]

xenobiotic catabolic process [inference]

phenylacetate catabolic process

catabolic process [inference]

lipid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

xenobiotic catabolic process [inference]

phenylacetate catabolic process

small molecule catabolic process [inference]

carboxylic acid catabolic process [inference]

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

phenylacetate catabolic process

biosynthetic process [inference]

lipid biosynthetic process [inference]

fatty acid biosynthetic process

fatty acid derivative biosynthetic process

small molecule biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

benzene-containing compound metabolic process [inference]

phenylacetate catabolic process

primary metabolic process [inference]

lipid metabolic process [inference]

fatty acid metabolic process [inference]

very long-chain fatty acid metabolic process

long-chain fatty acid metabolic process [inference]

fatty acid biosynthetic process

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

fatty acid oxidation [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

unsaturated fatty acid metabolic process [inference]

steroid metabolic process [inference]

bile acid metabolic process

lipid biosynthetic process [inference]

fatty acid biosynthetic process

fatty acid derivative biosynthetic process

lipid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

lipid modification [inference]

lipid oxidation [inference]

fatty acid oxidation [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

fatty acid derivative metabolic process [inference]

fatty acid derivative biosynthetic process

small molecule metabolic process [inference]

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

monocarboxylic acid metabolic process [inference]

fatty acid metabolic process [inference]

very long-chain fatty acid metabolic process

long-chain fatty acid metabolic process [inference]

fatty acid biosynthetic process

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

fatty acid oxidation [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

unsaturated fatty acid metabolic process [inference]

bile acid metabolic process

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

phenylacetate catabolic process

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

carboxylic acid catabolic process [inference]

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

phenylacetate catabolic process

small molecule catabolic process [inference]

carboxylic acid catabolic process [inference]

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

phenylacetate catabolic process

small molecule biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

olefinic compound metabolic process [inference]

alpha-linolenic acid metabolic process

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrion	HDA	PMID
peroxisome	ISS	GO_REF
peroxisome	ISO	GO_REF GO_REF
peroxisome	IEA	GO_REF
peroxisomal matrix	IDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

microbody lumen [inference]

peroxisomal matrix

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

microbody [inference]

peroxisome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

microbody [inference]

peroxisome

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
acetyl-CoA C-acetyltransferase activity	ISS	GO_REF
acetyl-CoA C-acetyltransferase activity	ISO	GO_REF
acetyl-CoA C-acetyltransferase activity	IEA	GO_REF GO_REF
acetyl-CoA C-acyltransferase activity	ISO	GO_REF
acetyl-CoA C-acyltransferase activity	IGI	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

acyltransferase activity [inference]

acyltransferase activity, transferring groups other than amino-acyl groups [inference]

acetyl-CoA C-acyltransferase activity

acetyl-CoA C-acetyltransferase activity

acetyltransferase activity [inference]

C-acetyltransferase activity [inference]

acetyl-CoA C-acetyltransferase activity

myristoyltransferase activity [inference]

acetyl-CoA C-myristoyltransferase activity

transferase activity, transferring sulphur-containing groups [inference]

CoA-transferase activity [inference]

acetate CoA-transferase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MHRLQVVLGHLAGRPESSSALQAAPCSAGFLQASASDVVVVHGRRTPIGRASRGCFKDTTPDELLSAVLTAVLQDVKLKPEQLGDISVGNVLQPGAGAIMARIAQFLSGIPETVPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTLSQRGNHGNISSRLLENEKARDCLIPMGITSENVAERFGVSRQKQDAFALASQQKAASAQSRGCFHAEIVPVTTTVLNDKGDKKTITVSQDEGVRPSTTMQGLAKLKPAFKDGGSTTAGNSSQVSDGAAAVLLARRSKAEELGLPILGVLRSYAVVGVPPDVMGIGPAYAIPAALQKAGLTVNDIDIFEINEAFASQAVYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRAYGVVSMCIGTGMGAAAVFEYPGN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
163			G62765YT	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Beta-oxidation of very long chain fatty acids	Mus musculus
Neutrophil degranulation	Mus musculus
Peroxisomal protein import	Mus musculus
alpha-linolenic acid (ALA) metabolism	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements