GlyCosmos Portal

Submissions

General transcription factor IIH subunit 3

Summary

UniProt ID: Q8VD76
Gene Symbol: Gtf2h3
Gene ID: 209357
Organism: Mus musculus (house mouse)

External Links

PubChem: Q8VD76
The O-GlcNAc Database: Q8VD76
Re-Glyco: Q8VD76

Annotation

Keyword: DNA repair Nucleus Reference proteome Transcription regulation Zinc-finger

Gene Ontology (GO)

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
nucleotide-excision repair	IBA	GO_REF
nucleotide-excision repair	IEA	GO_REF
regulation of DNA-templated transcription	IEA	GO_REF
regulation of transcription, DNA-templated	IEA	GO_REF
transcription by RNA polymerase II	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

nucleic acid metabolic process [inference]

DNA metabolic process [inference]

DNA repair [inference]

nucleotide-excision repair

RNA metabolic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

nucleic acid metabolic process [inference]

DNA metabolic process [inference]

DNA repair [inference]

nucleotide-excision repair

RNA metabolic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

cellular response to stimulus [inference]

cellular response to stress [inference]

DNA damage response [inference]

DNA repair [inference]

nucleotide-excision repair

response to stimulus [inference]

response to stress [inference]

cellular response to stress [inference]

DNA damage response [inference]

DNA repair [inference]

nucleotide-excision repair

cellular response to stimulus [inference]

cellular response to stress [inference]

DNA damage response [inference]

DNA repair [inference]

nucleotide-excision repair

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of RNA metabolic process [inference]

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
core TFIIH complex portion of holo TFIIH complex	ISS	GO_REF
core TFIIH complex portion of holo TFIIH complex	ISO	GO_REF
core TFIIH complex portion of holo TFIIH complex	IEA	GO_REF
transcription factor TFIIH core complex	IBA	GO_REF
transcription factor TFIIH core complex	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

transcription regulator complex [inference]

RNA polymerase II transcription regulator complex [inference]

transcription factor TFIIH core complex

core TFIIH complex portion of holo TFIIH complex

protein-DNA complex [inference]

transcription preinitiation complex

nuclear protein-containing complex [inference]

nuclear cyclin-dependent protein kinase holoenzyme complex [inference]

transcription factor TFIIH holo complex

carboxy-terminal domain protein kinase complex [inference]

transcription factor TFIIH holo complex

RNA polymerase II transcription regulator complex [inference]

transcription factor TFIIH core complex

core TFIIH complex portion of holo TFIIH complex

catalytic complex [inference]

transferase complex [inference]

transferase complex, transferring phosphorus-containing groups [inference]

protein kinase complex [inference]

serine/threonine protein kinase complex [inference]

cyclin-dependent protein kinase holoenzyme complex [inference]

nuclear cyclin-dependent protein kinase holoenzyme complex [inference]

transcription factor TFIIH holo complex

carboxy-terminal domain protein kinase complex [inference]

transcription factor TFIIH holo complex

cellular anatomical structure [inference]

nucleoplasm

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying **all 4** entries
GO Term	Evidence Code	Reference
zinc ion binding
RNA polymerase II general transcription initiation factor activity	ISO	GO_REF
RNA polymerase II general transcription initiation factor activity	IBA	GO_REF
RNA polymerase II general transcription initiation factor activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

general transcription initiation factor activity [inference]

RNA polymerase II general transcription initiation factor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAADEDELNLLVIIVDTNPIWWGKQALKESQFTLSKCMDAVMVLANSHLFMNRSNQLAVIASHIQESRLLYPGKNGGLGDFFGDPGNALPDCNPSGSKDGKYELLTVANEVIAEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRVNKAVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPIHVDYRAACFCHRSLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKQKVSL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
137		34418053	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 19 in total

1

2

Next ›

Last »
Pathway Name	Organism
Dual Incision in GG-NER	Mus musculus
Dual incision in TC-NER	Mus musculus
Formation of Incision Complex in GG-NER	Mus musculus
Formation of RNA Pol II elongation complex	Mus musculus
Formation of TC-NER Pre-Incision Complex	Mus musculus
Formation of the Early Elongation Complex	Mus musculus
Gap-filling DNA repair synthesis and ligation in TC-NER	Mus musculus
RNA Pol II CTD phosphorylation and interaction with CE	Mus musculus
RNA Polymerase I Promoter Escape	Mus musculus
RNA Polymerase I Transcription Initiation	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements