GlyCosmos Portal

Submissions

Lysosomal phospholipase A and acyltransferase

Summary

UniProt ID: Q8VEB4
Gene Symbol: Lypla3 Pla2g15
Gene ID: 192654
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB

GPDB0006985

GlyConnect

Group XV phospholipase A2

GlyGen

Q8VEB4

PubChem

Q8VEB4

SwissLipids

SLP:000000352

Re-Glyco

Q8VEB4

Annotation

Keyword: Acyltransferase Disulfide bond Fatty acid metabolism Glycoprotein Hydrolase Lysosome Membrane Metal-binding Reference proteome Secreted Signal Zinc

Gene Ontology (GO)

Displaying entries **1 - 5** of 22 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
fatty acid metabolic process
glycerophospholipid metabolic process	ISO	GO_REF
glycerophospholipid metabolic process	IDA	PMID
glycerophospholipid metabolic process	IEA	GO_REF
diacylglycerol biosynthetic process	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

modified amino acid metabolic process [inference]

phosphatidylserine metabolic process

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process

phosphatidylserine metabolic process

phosphatidylethanolamine metabolic process [inference]

phosphatidylethanolamine catabolic process

phosphatidylcholine metabolic process

phosphatidylcholine catabolic process

phosphatidylglycerol metabolic process

glycerophospholipid catabolic process [inference]

phospholipid catabolic process [inference]

glycerophospholipid catabolic process [inference]

organophosphate metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process

phosphatidylserine metabolic process

phosphatidylethanolamine metabolic process [inference]

phosphatidylethanolamine catabolic process

phosphatidylcholine metabolic process

phosphatidylcholine catabolic process

phosphatidylglycerol metabolic process

glycerophospholipid catabolic process [inference]

phospholipid catabolic process [inference]

glycerophospholipid catabolic process [inference]

organophosphate catabolic process [inference]

phospholipid catabolic process [inference]

glycerophospholipid catabolic process [inference]

catabolic process [inference]

lipid catabolic process [inference]

phospholipid catabolic process [inference]

glycerophospholipid catabolic process [inference]

glycerolipid catabolic process [inference]

glycerophospholipid catabolic process [inference]

organophosphate catabolic process [inference]

phospholipid catabolic process [inference]

glycerophospholipid catabolic process [inference]

biosynthetic process [inference]

lipid biosynthetic process [inference]

glycerolipid biosynthetic process [inference]

acylglycerol biosynthetic process [inference]

diacylglycerol biosynthetic process

neutral lipid biosynthetic process [inference]

acylglycerol biosynthetic process [inference]

diacylglycerol biosynthetic process

primary metabolic process [inference]

lipid metabolic process [inference]

fatty acid metabolic process

neutral lipid metabolic process [inference]

acylglycerol metabolic process [inference]

diacylglycerol metabolic process [inference]

diacylglycerol biosynthetic process

acylglycerol biosynthetic process [inference]

diacylglycerol biosynthetic process

neutral lipid biosynthetic process [inference]

acylglycerol biosynthetic process [inference]

diacylglycerol biosynthetic process

phospholipid metabolic process [inference]

glycerophospholipid metabolic process

phosphatidylserine metabolic process

phosphatidylethanolamine metabolic process [inference]

phosphatidylethanolamine catabolic process

phosphatidylcholine metabolic process

phosphatidylcholine catabolic process

phosphatidylglycerol metabolic process

glycerophospholipid catabolic process [inference]

phospholipid catabolic process [inference]

glycerophospholipid catabolic process [inference]

sphingolipid metabolic process [inference]

ceramide metabolic process

lipid biosynthetic process [inference]

glycerolipid biosynthetic process [inference]

acylglycerol biosynthetic process [inference]

diacylglycerol biosynthetic process

neutral lipid biosynthetic process [inference]

acylglycerol biosynthetic process [inference]

diacylglycerol biosynthetic process

lipid catabolic process [inference]

phospholipid catabolic process [inference]

glycerophospholipid catabolic process [inference]

glycerolipid catabolic process [inference]

glycerophospholipid catabolic process [inference]

glycerolipid metabolic process [inference]

acylglycerol metabolic process [inference]

diacylglycerol metabolic process [inference]

diacylglycerol biosynthetic process

acylglycerol biosynthetic process [inference]

diacylglycerol biosynthetic process

glycerophospholipid metabolic process

phosphatidylserine metabolic process

phosphatidylethanolamine metabolic process [inference]

phosphatidylethanolamine catabolic process

phosphatidylcholine metabolic process

phosphatidylcholine catabolic process

phosphatidylglycerol metabolic process

glycerophospholipid catabolic process [inference]

glycerolipid biosynthetic process [inference]

acylglycerol biosynthetic process [inference]

diacylglycerol biosynthetic process

glycerolipid catabolic process [inference]

glycerophospholipid catabolic process [inference]

small molecule metabolic process [inference]

organic acid metabolic process [inference]

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

monocarboxylic acid metabolic process [inference]

fatty acid metabolic process

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
nucleoplasm	ISO	GO_REF
mitochondrion	HDA	PMID
lysosome	ISS	GO_REF
lysosome	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

vacuole [inference]

lytic vacuole [inference]

lysosome

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
phosphatidylcholine lysophospholipase A1 activity	IDA	PMID
zinc ion binding	ISS	GO_REF
zinc ion binding	ISO	GO_REF
zinc ion binding	IEA	GO_REF
O-acyltransferase activity

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

acyltransferase activity [inference]

acyltransferase activity, transferring groups other than amino-acyl groups [inference]

O-acyltransferase activity

acylglycerol O-acyltransferase activity

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

lipase activity [inference]

phospholipase activity [inference]

glycerophospholipase activity [inference]

A1-type glycerophospholipase activity [inference]

glycerophospholipid phospholipase A1 activity

lysophospholipase A1 activity [inference]

phosphatidylcholine lysophospholipase A1 activity

carboxylic ester hydrolase activity [inference]

A1-type glycerophospholipase activity [inference]

glycerophospholipid phospholipase A1 activity

lysophospholipase A1 activity [inference]

phosphatidylcholine lysophospholipase A1 activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDRHLCTCRETQLRSGLLLPLFLLMMLADLTLPAQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
99	N-linked (GlcNAc...) asparagine	30899004	G14943SF G93180LE G39188ZX G06110VR G66538GV G74724QE G14669DU	UniProt GlyGen GlyConnect
273	N-linked (GlcNAc...) asparagine	30899004	G66538GV G74724QE G14669DU	GlycoProtDB UniProt GlyGen GlyConnect
289	N-linked (GlcNAc...) asparagine	30899004	G15664MX G05724UK G93180LE G39188ZX G06110VR G66538GV G14669DU	GlycoProtDB UniProt GlyGen GlyConnect
398	N-linked (GlcNAc...) asparagine	30899004	G80920RR G05724UK	GlycoProtDB UniProt GlyGen GlyConnect