GlyCosmos Portal

Submissions

Coxsackievirus and adenovirus receptor homolog

Summary

UniProt ID: Q8WMV3
Gene Symbol: CXADR CAR
Gene ID: 281733
Organism: Bos taurus (domestic cattle)

External Links

PubChem: Q8WMV3
RaftProt: Q8WMV3
Re-Glyco: Q8WMV3

Annotation

Keyword: Cell adhesion Cell membrane Disulfide bond Glycoprotein Immunoglobulin domain Palmitate Phosphoprotein Receptor Reference proteome Repeat Signal Tight junction Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrion organization	ISS	GO_REF
heterophilic cell-cell adhesion	ISS	GO_REF
heart development	ISS	GO_REF
germ cell migration	ISS	GO_REF
epithelial structure maintenance	ISS	GO_REF

GO Hierarchy

biological process

immune system process [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

gamma-delta T cell activation

leukocyte migration [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

myeloid leukocyte migration [inference]

granulocyte migration [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

neutrophil migration [inference]

neutrophil chemotaxis

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

gamma-delta T cell activation

cell communication [inference]

cell communication involved in cardiac conduction [inference]

AV node cell to bundle of His cell communication

cell adhesion [inference]

cell-cell adhesion [inference]

actin filament-based process [inference]

actin cytoskeleton organization

cellular developmental process [inference]

cell development [inference]

muscle cell development [inference]

striated muscle cell development [inference]

cardiac muscle cell development

cardiac cell development [inference]

cardiac muscle cell development

cell motility [inference]

cell migration [inference]

germ cell migration

leukocyte migration [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

myeloid leukocyte migration [inference]

granulocyte migration [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

neutrophil migration [inference]

neutrophil chemotaxis

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

mitochondrion organization

cytoskeleton organization [inference]

actin cytoskeleton organization

cell junction organization [inference]

cell-cell junction organization

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

gamma-delta T cell activation

multicellular organismal-level homeostasis [inference]

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

epithelial structure maintenance

developmental process [inference]

anatomical structure development [inference]

cell development [inference]

muscle cell development [inference]

striated muscle cell development [inference]

cardiac muscle cell development

cardiac cell development [inference]

cardiac muscle cell development

animal organ development [inference]

heart development

cellular developmental process [inference]

cell development [inference]

muscle cell development [inference]

striated muscle cell development [inference]

cardiac muscle cell development

cardiac cell development [inference]

cardiac muscle cell development

locomotion [inference]

taxis [inference]

chemotaxis [inference]

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

epithelial structure maintenance

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
acrosomal vesicle	ISS	GO_REF
nucleus	ISS	GO_REF
cytoplasm	ISS	GO_REF
plasma membrane	ISS	GO_REF
plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

membrane [inference]

plasma membrane

plasma membrane region [inference]

membrane microdomain [inference]

membrane raft

cell junction [inference]

anchoring junction [inference]

cell-cell junction [inference]

adherens junction

cell-cell contact zone [inference]

intercalated disc

tight junction [inference]

bicellular tight junction

site of polarized growth [inference]

growth cone

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection

actin-based cell projection [inference]

filopodium

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule [inference]

acrosomal vesicle

intracellular membrane-bounded organelle [inference]

nucleus

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule [inference]

acrosomal vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule [inference]

acrosomal vesicle

cell body

Displaying **all 5** entries
GO Term	Evidence Code	Reference
beta-catenin binding	ISS	GO_REF
PDZ domain binding	ISS	GO_REF
cell adhesion molecule binding	ISS	GO_REF
cell adhesion molecule binding	IBA	GO_REF
connexin binding	ISS	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

beta-catenin binding

protein domain specific binding [inference]

PDZ domain binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MELLLRFLLLCGVADFTRGLSITTPEQMIEKAKGETAYLPCKFTLGPEDQGPLDIEWLLSPADNQKVDQVIILYSGDKIYDDYYQDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVGNKKIQLTVLVKPSGIRCYVDGSEEIGNDFKLKCEPKEGSLPLRYEWQKLSDSQKLPTSWLPEMTSPVISVKNASAEYSGTYTCTVRNRVGSDQCLLRLDVVPPSNRAGTIAGAVIGTLLALVLIALIVFCCHKKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDLERAPQSPTLPPAKVAAPNLSRMGAVPVMIPAQSKDGSIV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
106	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Cell surface interactions at the vascular wall	Bos taurus
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell	Bos taurus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements