GlyCosmos Portal

Submissions

Vacuolar protein-sorting-associated protein 36

Summary

UniProt ID: Q91XD6
Gene Symbol: Vps36
Gene ID: 70160
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q91XD6
PubChem: Q91XD6
The O-GlcNAc Database: Q91XD6
O-GlcNAcAtlas: Q91XD6
Re-Glyco: Q91XD6

Annotation

Keyword: 3D-structure Coiled coil Cytoplasm Endosome Lipid-binding Membrane Nucleus Protein transport Reference proteome Transcription regulation

Gene Ontology (GO)

Displaying **all 2** entries
GO Term	Evidence Code	Reference
endosomal transport	IC	PMID
protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

intercellular transport [inference]

late endosome to vacuole transport [inference]

late endosome to vacuole transport via multivesicular body sorting pathway [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

vesicle-mediated transport [inference]

endosomal transport

endosome transport via multivesicular body sorting pathway [inference]

late endosome to vacuole transport via multivesicular body sorting pathway [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

late endosome to vacuole transport [inference]

late endosome to vacuole transport via multivesicular body sorting pathway [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

multivesicular body sorting pathway [inference]

endosome transport via multivesicular body sorting pathway [inference]

late endosome to vacuole transport via multivesicular body sorting pathway [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

vacuolar transport [inference]

late endosome to vacuole transport [inference]

late endosome to vacuole transport via multivesicular body sorting pathway [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

endosomal transport

endosome transport via multivesicular body sorting pathway [inference]

late endosome to vacuole transport via multivesicular body sorting pathway [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

protein localization to organelle [inference]

protein localization to vacuole [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

establishment of localization [inference]

transport [inference]

intercellular transport [inference]

late endosome to vacuole transport [inference]

late endosome to vacuole transport via multivesicular body sorting pathway [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

protein transport [inference]

intracellular protein transport [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

vesicle-mediated transport [inference]

endosomal transport

endosome transport via multivesicular body sorting pathway [inference]

late endosome to vacuole transport via multivesicular body sorting pathway [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

late endosome to vacuole transport [inference]

late endosome to vacuole transport via multivesicular body sorting pathway [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

multivesicular body sorting pathway [inference]

endosome transport via multivesicular body sorting pathway [inference]

late endosome to vacuole transport via multivesicular body sorting pathway [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

intracellular transport [inference]

intracellular protein transport [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

vacuolar transport [inference]

late endosome to vacuole transport [inference]

late endosome to vacuole transport via multivesicular body sorting pathway [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

endosomal transport

endosome transport via multivesicular body sorting pathway [inference]

late endosome to vacuole transport via multivesicular body sorting pathway [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

establishment of protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

establishment of protein localization to organelle [inference]

establishment of protein localization to vacuole [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

vacuolar transport [inference]

late endosome to vacuole transport [inference]

late endosome to vacuole transport via multivesicular body sorting pathway [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

endosomal transport

endosome transport via multivesicular body sorting pathway [inference]

late endosome to vacuole transport via multivesicular body sorting pathway [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

vacuolar transport [inference]

late endosome to vacuole transport [inference]

late endosome to vacuole transport via multivesicular body sorting pathway [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

endosomal transport

endosome transport via multivesicular body sorting pathway [inference]

late endosome to vacuole transport via multivesicular body sorting pathway [inference]

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
ESCRT II complex	ISO	GO_REF
ESCRT II complex	IBA	GO_REF
ESCRT II complex	IEA	GO_REF GO_REF
nucleus	IEA	GO_REF
lysosome	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

ESCRT complex [inference]

ESCRT II complex

membrane protein complex [inference]

ESCRT II complex

cellular anatomical structure [inference]

cytosol

membrane [inference]

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane [inference]

late endosome membrane

bounding membrane of organelle [inference]

endosome membrane [inference]

late endosome membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

late endosome

intracellular membrane-bounded organelle [inference]

nucleus

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

late endosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

late endosome

Displaying **all 4** entries
GO Term	Evidence Code	Reference
phosphatidylinositol-3-phosphate binding	IEA	GO_REF
ubiquitin binding	ISO	GO_REF
ubiquitin binding	IDA	PMID
ubiquitin binding	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

ubiquitin-like protein binding [inference]

ubiquitin binding

lipid binding [inference]

phospholipid binding [inference]

phosphatidylinositol phosphate binding [inference]

phosphatidylinositol-3-phosphate binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDRFVWTSGLLEINETLVIQQRGVRVYDGEEKIKFDAGTLLLSTHRLIWRDQKNNECCMAIPLSQIVFIEEQAAGIGKSAKIVVHLHPAPSNKEPGPFQSSKNSYIRLSFKEHGQIEFYRRLSEEMTQRRWETVPVSQSLQTNKGPQPGRVRAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMIKAKEMVELSKSIANKIKEKQGDVTEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQAPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEALKLPIRLRVFDSGVMVIELQTHKEEEMVASALETVSERGSLTSEEFAKLVGMSVLLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFMTQN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites