GlyCosmos Portal

Submissions

Brain acid soluble protein 1

Summary

UniProt ID: Q91XV3
Gene Symbol: Basp1 Nap22
Gene ID: 70350
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q91XV3
The O-GlcNAc Database: Q91XV3
RaftProt: Q91XV3
O-GlcNAcAtlas: Q91XV3
Re-Glyco: Q91XV3

Annotation

Keyword: Cell membrane Cell projection Direct protein sequencing Isopeptide bond Myristate Phosphoprotein Reference proteome Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of DNA-templated transcription	ISS	PMID GO_REF
negative regulation of transcription, DNA-templated	ISS	PMID GO_REF
negative regulation of transcription, DNA-templated	ISO	GO_REF
negative regulation of DNA-templated transcription	ISO	GO_REF
negative regulation of transcription, DNA-templated	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation [inference]

epithelial cell differentiation involved in kidney development [inference]

glomerular epithelial cell differentiation [inference]

podocyte differentiation

cell differentiation involved in kidney development [inference]

epithelial cell differentiation involved in kidney development [inference]

glomerular epithelial cell differentiation [inference]

podocyte differentiation

renal filtration cell differentiation [inference]

podocyte differentiation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

protein-containing complex assembly [inference]

protein complex oligomerization [inference]

protein homooligomerization

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

protein complex oligomerization [inference]

protein homooligomerization

supramolecular fiber organization

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation [inference]

epithelial cell differentiation involved in kidney development [inference]

glomerular epithelial cell differentiation [inference]

podocyte differentiation

cell differentiation involved in kidney development [inference]

epithelial cell differentiation involved in kidney development [inference]

glomerular epithelial cell differentiation [inference]

podocyte differentiation

renal filtration cell differentiation [inference]

podocyte differentiation

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

Displaying entries **1 - 5** of 20 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
chromatin	IDA	PMID
nucleus	ISO	GO_REF
nucleus	IDA	PMID
nucleus	IBA	GO_REF
nucleus	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

nuclear protein-containing complex [inference]

COP9 signalosome

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

site of polarized growth [inference]

growth cone

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

nuclear body [inference]

PML body

nuclear ribonucleoprotein granule [inference]

nuclear speck

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

nuclear body [inference]

PML body

nuclear ribonucleoprotein granule [inference]

nuclear speck

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

supramolecular complex [inference]

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
transcription cis-regulatory region binding	IDA	PMID
transcription cis-regulatory region binding	IBA	GO_REF
transcription corepressor activity	ISS	PMID
transcription corepressor activity	ISO	GO_REF
transcription corepressor activity	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

transcription regulatory region nucleic acid binding [inference]

transcription cis-regulatory region binding

DNA binding [inference]

double-stranded DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding

sequence-specific DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding

protein binding [inference]

transcription regulator activity [inference]

transcription coregulator activity [inference]

transcription corepressor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGGKLSKKKKGYNVNDEKAKDKDKKAEGAGTEEEGTPKESEPQAAADATEVKESTEEKPKDAADGEAKAEEKEADKAAAAKEEAPKAEPEKSEGAAEEQPEPAPAPEQEAAAPGPAAGGEAPKAGEASAESTGAADGAAPEEGEAKKTEAPAAAGPEAKSDAAPAASDSKPSSAEPAPSSKETPAASEAPSSAAKAPAPAAPAAAEPQAEAPAAAASSEQSVAVKE

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites