GlyCosmos Portal

Submissions

Egl nine homolog 1

Summary

UniProt ID: Q91YE3
Gene Symbol: Egln1
Gene ID: 112405
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q91YE3
Re-Glyco: Q91YE3

Annotation

Keyword: Acetylation Cytoplasm Dioxygenase Iron Nucleus Phosphoprotein Reference proteome S-nitrosylation Vitamin C Zinc-finger

Gene Ontology (GO)

Displaying entries **1 - 5** of 27 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
response to hypoxia	ISO	GO_REF GO_REF
response to hypoxia	IEA	GO_REF
intracellular iron ion homeostasis	IMP	PMID
intracellular oxygen homeostasis	ISO	GO_REF
intracellular oxygen homeostasis	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to hypoxia

cellular response to chemical stimulus [inference]

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

developmental process [inference]

anatomical structure morphogenesis [inference]

tissue morphogenesis [inference]

muscle tissue morphogenesis [inference]

cardiac muscle tissue morphogenesis

cardiac septum morphogenesis [inference]

ventricular septum morphogenesis

anatomical structure formation involved in morphogenesis [inference]

trabecula formation [inference]

heart trabecula formation

anatomical structure development [inference]

labyrinthine layer development

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular iron ion homeostasis

intracellular oxygen homeostasis

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular iron ion homeostasis

monoatomic cation homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular iron ion homeostasis

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular iron ion homeostasis

intracellular oxygen homeostasis

inorganic ion homeostasis [inference]

intracellular iron ion homeostasis

response to stimulus [inference]

response to stress [inference]

response to hypoxia

cellular response to hypoxia

cellular response to stress [inference]

cellular response to hypoxia

response to abiotic stimulus [inference]

response to oxygen levels [inference]

response to decreased oxygen levels [inference]

response to hypoxia

cellular response to hypoxia

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

response to chemical [inference]

cellular response to chemical stimulus [inference]

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

response to nitrogen compound [inference]

response to nitric oxide

response to oxygen-containing compound [inference]

response to nitric oxide

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to hypoxia

cellular response to chemical stimulus [inference]

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of calcium-mediated signaling [inference]

negative regulation of CAMKK-AMPK signaling cascade

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

regulation of intracellular signal transduction [inference]

regulation of calcium-mediated signaling [inference]

negative regulation of calcium-mediated signaling [inference]

negative regulation of CAMKK-AMPK signaling cascade

regulation of CAMKK-AMPK signaling cascade [inference]

negative regulation of CAMKK-AMPK signaling cascade

regulation of hypoxia-inducible factor-1alpha signaling pathway [inference]

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of calcium-mediated signaling [inference]

negative regulation of CAMKK-AMPK signaling cascade

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of calcium-mediated signaling [inference]

negative regulation of CAMKK-AMPK signaling cascade

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of neuron apoptotic process

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of calcium-mediated signaling [inference]

negative regulation of CAMKK-AMPK signaling cascade

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of calcium-mediated signaling [inference]

negative regulation of CAMKK-AMPK signaling cascade

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

negative regulation of cellular response to hypoxia [inference]

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of calcium-mediated signaling [inference]

negative regulation of CAMKK-AMPK signaling cascade

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

negative regulation of cellular response to hypoxia [inference]

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of calcium-mediated signaling [inference]

negative regulation of CAMKK-AMPK signaling cascade

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

regulation of intracellular signal transduction [inference]

regulation of calcium-mediated signaling [inference]

negative regulation of calcium-mediated signaling [inference]

negative regulation of CAMKK-AMPK signaling cascade

regulation of CAMKK-AMPK signaling cascade [inference]

negative regulation of CAMKK-AMPK signaling cascade

regulation of hypoxia-inducible factor-1alpha signaling pathway [inference]

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of calcium-mediated signaling [inference]

negative regulation of CAMKK-AMPK signaling cascade

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of calcium-mediated signaling [inference]

negative regulation of CAMKK-AMPK signaling cascade

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

negative regulation of cellular response to hypoxia [inference]

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of cellular response to hypoxia [inference]

negative regulation of cellular response to hypoxia [inference]

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of calcium-mediated signaling [inference]

negative regulation of CAMKK-AMPK signaling cascade

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

regulation of intracellular signal transduction [inference]

regulation of calcium-mediated signaling [inference]

negative regulation of calcium-mediated signaling [inference]

negative regulation of CAMKK-AMPK signaling cascade

regulation of CAMKK-AMPK signaling cascade [inference]

negative regulation of CAMKK-AMPK signaling cascade

regulation of hypoxia-inducible factor-1alpha signaling pathway [inference]

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of calcium-mediated signaling [inference]

negative regulation of CAMKK-AMPK signaling cascade

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of calcium-mediated signaling [inference]

negative regulation of CAMKK-AMPK signaling cascade

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of catabolic process [inference]

regulation protein catabolic process at synapse [inference]

regulation protein catabolic process at postsynapse

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process

positive regulation of neuron apoptotic process

regulation of neuron apoptotic process

positive regulation of neuron apoptotic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of neuron apoptotic process

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of neuron apoptotic process

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of calcium-mediated signaling [inference]

negative regulation of CAMKK-AMPK signaling cascade

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

negative regulation of cellular response to hypoxia [inference]

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

regulation of cellular component organization [inference]

regulation of synapse organization [inference]

regulation of modification of synaptic structure [inference]

regulation of modification of postsynaptic structure

regulation of cellular response to stress [inference]

regulation of cellular response to hypoxia [inference]

negative regulation of cellular response to hypoxia [inference]

negative regulation of hypoxia-inducible factor-1alpha signaling pathway

regulation of multicellular organismal process [inference]

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	ISS	GO_REF
nucleus	ISO	GO_REF
nucleus	IBA	GO_REF
nucleus	IEA	GO_REF
cytoplasm	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell junction [inference]

synapse [inference]

glutamatergic synapse

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

postsynaptic specialization [inference]

postsynaptic density

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
enzyme inhibitor activity	ISO	GO_REF
ferrous iron binding	ISS	GO_REF
ferrous iron binding	ISO	GO_REF
ferrous iron binding	IBA	GO_REF
ferrous iron binding	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [inference]

2-oxoglutarate-dependent dioxygenase activity

peptidyl-proline dioxygenase activity

peptidyl-proline 4-dioxygenase activity

hypoxia-inducible factor-proline dioxygenase activity

dioxygenase activity [inference]

2-oxoglutarate-dependent dioxygenase activity

peptidyl-proline dioxygenase activity

peptidyl-proline 4-dioxygenase activity

hypoxia-inducible factor-proline dioxygenase activity

catalytic activity, acting on a protein [inference]

peptidyl-proline dioxygenase activity

peptidyl-proline 4-dioxygenase activity

hypoxia-inducible factor-proline dioxygenase activity

binding [inference]

protein binding [inference]

enzyme binding

carbohydrate binding [inference]

monosaccharide binding [inference]

L-ascorbic acid binding

small molecule binding [inference]

vitamin binding [inference]

L-ascorbic acid binding

ion binding [inference]

anion binding [inference]

carboxylic acid binding [inference]

L-ascorbic acid binding

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

iron ion binding [inference]

ferrous iron binding

zinc ion binding

organic acid binding [inference]

carboxylic acid binding [inference]

L-ascorbic acid binding

monosaccharide binding [inference]

L-ascorbic acid binding

heterocyclic compound binding [inference]

L-ascorbic acid binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity

molecular function inhibitor activity [inference]

enzyme inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MASDSGGPGVLSASERDRQYCELCGKMENLLRCGRCRSSFYCCKEHQRQDWKKHKLVCQGGEAPRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSAAASRVPGPEDAAQARSGPGPAEPGSEDPPLSRSPGPERASLCPAGGGPGEALSPGGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDQITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites