GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Argininosuccinate lyase

Summary

UniProt ID: Q91YI0
Gene Symbol: Asl
Gene ID: 109900
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q91YI0
PubChem: Q91YI0
Re-Glyco: Q91YI0

Annotation

Keyword: Acetylation Arginine biosynthesis Lyase Reference proteome Urea cycle

Gene Ontology (GO)

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
urea cycle	ISO	GO_REF
urea cycle	IEA	GO_REF
obsolete argininosuccinate metabolic process
liver development	ISO	GO_REF
amino acid metabolic process	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

urea cycle

amino acid biosynthetic process [inference]

alpha-amino acid biosynthetic process [inference]

L-amino acid biosynthetic process [inference]

L-glutamine family amino acid biosynthetic process [inference]

L-arginine biosynthetic process

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

proteinogenic amino acid biosynthetic process [inference]

L-glutamine family amino acid biosynthetic process [inference]

L-arginine biosynthetic process

alpha-amino acid biosynthetic process [inference]

L-amino acid biosynthetic process [inference]

L-glutamine family amino acid biosynthetic process [inference]

L-arginine biosynthetic process

primary metabolic process [inference]

amino acid metabolic process

amino acid biosynthetic process [inference]

alpha-amino acid biosynthetic process [inference]

L-amino acid biosynthetic process [inference]

L-glutamine family amino acid biosynthetic process [inference]

L-arginine biosynthetic process

proteinogenic amino acid metabolic process [inference]

L-glutamine metabolic process [inference]

ammonia assimilation cycle

proteinogenic amino acid biosynthetic process [inference]

L-glutamine family amino acid biosynthetic process [inference]

L-arginine biosynthetic process

alpha-amino acid metabolic process [inference]

arginine metabolic process

L-arginine biosynthetic process

glutamate metabolic process [inference]

ammonia assimilation cycle

L-amino acid metabolic process [inference]

L-glutamine metabolic process [inference]

ammonia assimilation cycle

L-amino acid biosynthetic process [inference]

L-glutamine family amino acid biosynthetic process [inference]

L-arginine biosynthetic process

alpha-amino acid biosynthetic process [inference]

L-amino acid biosynthetic process [inference]

L-glutamine family amino acid biosynthetic process [inference]

L-arginine biosynthetic process

small molecule metabolic process [inference]

organic acid metabolic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

proteinogenic amino acid biosynthetic process [inference]

L-glutamine family amino acid biosynthetic process [inference]

L-arginine biosynthetic process

alpha-amino acid biosynthetic process [inference]

L-amino acid biosynthetic process [inference]

L-glutamine family amino acid biosynthetic process [inference]

L-arginine biosynthetic process

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

dicarboxylic acid metabolic process [inference]

glutamate metabolic process [inference]

ammonia assimilation cycle

carboxylic acid biosynthetic process [inference]

proteinogenic amino acid biosynthetic process [inference]

L-glutamine family amino acid biosynthetic process [inference]

L-arginine biosynthetic process

alpha-amino acid biosynthetic process [inference]

L-amino acid biosynthetic process [inference]

L-glutamine family amino acid biosynthetic process [inference]

L-arginine biosynthetic process

proteinogenic amino acid metabolic process [inference]

L-glutamine metabolic process [inference]

ammonia assimilation cycle

proteinogenic amino acid biosynthetic process [inference]

L-glutamine family amino acid biosynthetic process [inference]

L-arginine biosynthetic process

alpha-amino acid metabolic process [inference]

arginine metabolic process

L-arginine biosynthetic process

glutamate metabolic process [inference]

ammonia assimilation cycle

L-amino acid metabolic process [inference]

L-glutamine metabolic process [inference]

ammonia assimilation cycle

L-amino acid biosynthetic process [inference]

L-glutamine family amino acid biosynthetic process [inference]

L-arginine biosynthetic process

alpha-amino acid biosynthetic process [inference]

L-amino acid biosynthetic process [inference]

L-glutamine family amino acid biosynthetic process [inference]

L-arginine biosynthetic process

urea metabolic process [inference]

urea cycle

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

proteinogenic amino acid biosynthetic process [inference]

L-glutamine family amino acid biosynthetic process [inference]

L-arginine biosynthetic process

alpha-amino acid biosynthetic process [inference]

L-amino acid biosynthetic process [inference]

L-glutamine family amino acid biosynthetic process [inference]

L-arginine biosynthetic process

nitrogen cycle metabolic process [inference]

urea metabolic process [inference]

urea cycle

multicellular organismal process [inference]

behavior [inference]

locomotory behavior

post-embryonic development

developmental process [inference]

anatomical structure development [inference]

animal organ development [inference]

gland development [inference]

liver development

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular nitrogen homeostasis [inference]

nitrogen utilization [inference]

ammonia assimilation cycle

chemical homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular nitrogen homeostasis [inference]

nitrogen utilization [inference]

ammonia assimilation cycle

response to stimulus [inference]

response to nutrient levels [inference]

nitrogen utilization [inference]

ammonia assimilation cycle

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of nitric oxide biosynthetic process

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of nitric oxide biosynthetic process

regulation of nitric oxide biosynthetic process [inference]

positive regulation of nitric oxide biosynthetic process

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of nitric oxide biosynthetic process

regulation of nitric oxide metabolic process [inference]

regulation of nitric oxide biosynthetic process [inference]

positive regulation of nitric oxide biosynthetic process

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of nitric oxide biosynthetic process

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrial outer membrane	ISO	GO_REF
cytosol	IBA	GO_REF
neuronal cell body	ISO	GO_REF
perikaryon	ISO	GO_REF
perinuclear region of cytoplasm	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytosol

membrane [inference]

outer membrane [inference]

organelle outer membrane [inference]

mitochondrial outer membrane

organelle membrane [inference]

mitochondrial membrane [inference]

mitochondrial outer membrane

bounding membrane of organelle [inference]

organelle outer membrane [inference]

mitochondrial outer membrane

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

cell body fiber

perikaryon

cell body [inference]

neuronal cell body

perinuclear region of cytoplasm

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
argininosuccinate lyase activity	ISS	GO_REF
argininosuccinate lyase activity	ISO	GO_REF GO_REF
argininosuccinate lyase activity	IBA	GO_REF
argininosuccinate lyase activity	IEA	GO_REF GO_REF GO_REF GO_REF
identical protein binding	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

lyase activity [inference]

carbon-nitrogen lyase activity [inference]

amidine-lyase activity [inference]

argininosuccinate lyase activity

binding [inference]

protein binding [inference]

identical protein binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MASESGKLWGGRFVGAVDPIMEKFNSSISYDRHLWNVDVQGSKAYSRGLEKAGLLTKAEMQQILQGLDKVAEEWAQGTFKLHPNDEDIHTANERRLKELIGEAAGKLHTGRSRNDQVVTDLRLWMRQTCSKLSALLRVLIGTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVQKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYGTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMIAVLQVATGVISTLQIHRENMKQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNLLSLQELQTISPLFSGDVSHVWDYSHSVEQYSALGGTAKSSVEWQIRQVRALLQAQEP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
25			G02815KT	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Urea cycle	Mus musculus

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:14755	argininosuccinic aciduria	Alliance of Genome Resources

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026