GlyCosmos Portal

Submissions

Secreted frizzled-related protein 3

Summary

UniProt ID

Q92765

Gene Symbol

FIZ
FRE
FRP
FRZB
FRZB1
SFRP3

Gene ID

[2487]

Organism

Homo sapiens (human)

External Links

GlyConnect

Secreted frizzled-related protein 3

GlyGen

Q92765

Re-Glyco

Q92765

Annotation

Keyword: Developmental protein Differentiation Direct protein sequencing Disease variant Disulfide bond Glycoprotein Proteomics identification Reference proteome Secreted Signal Wnt signaling pathway

Gene Ontology (GO)

Displaying entries **1 - 5** of 25 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
skeletal system development	TAS	PMID
skeletal system development	IEA	GO_REF
epithelial cell development
negative regulation of cell population proliferation	IDA	PMID
negative regulation of cell population proliferation	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Wnt signaling pathway [inference]

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation [inference]

hepatocyte differentiation

mesenchymal cell differentiation [inference]

neural crest cell differentiation

stem cell differentiation [inference]

neural crest cell differentiation

cell development [inference]

epithelial cell development

developmental process [inference]

anatomical structure morphogenesis [inference]

embryonic morphogenesis [inference]

cochlea morphogenesis

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

convergent extension [inference]

convergent extension involved in organogenesis

anatomical structure development [inference]

tissue development [inference]

epithelium development [inference]

somite development

cell development [inference]

epithelial cell development

system development [inference]

skeletal system development

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation [inference]

hepatocyte differentiation

mesenchymal cell differentiation [inference]

neural crest cell differentiation

stem cell differentiation [inference]

neural crest cell differentiation

cell development [inference]

epithelial cell development

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

regulation of growth [inference]

regulation of cell growth [inference]

negative regulation of cell growth

negative regulation of growth [inference]

negative regulation of cell growth

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of cell differentiation [inference]

positive regulation of fat cell differentiation

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of fat cell differentiation

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

negative regulation of growth [inference]

negative regulation of cell growth

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

negative regulation of cell growth

negative regulation of cell differentiation [inference]

negative regulation of cell development

negative regulation of epithelial cell differentiation [inference]

negative regulation of hepatocyte differentiation

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development

negative regulation of epithelial cell differentiation [inference]

negative regulation of hepatocyte differentiation

negative regulation of cartilage development

negative regulation of multicellular organismal process [inference]

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

regulation of developmental process [inference]

regulation of cell differentiation [inference]

regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation [inference]

negative regulation of hepatocyte differentiation

regulation of hepatocyte differentiation [inference]

negative regulation of hepatocyte differentiation

negative regulation of cell differentiation [inference]

negative regulation of cell development

negative regulation of epithelial cell differentiation [inference]

negative regulation of hepatocyte differentiation

positive regulation of cell differentiation [inference]

positive regulation of fat cell differentiation

regulation of fat cell differentiation [inference]

positive regulation of fat cell differentiation

regulation of cell development [inference]

negative regulation of cell development

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development

negative regulation of epithelial cell differentiation [inference]

negative regulation of hepatocyte differentiation

negative regulation of cartilage development

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of fat cell differentiation

regulation of multicellular organismal development [inference]

regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation [inference]

negative regulation of hepatocyte differentiation

regulation of hepatocyte differentiation [inference]

negative regulation of hepatocyte differentiation

regulation of cartilage development [inference]

negative regulation of cartilage development

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Wnt signaling pathway [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

regulation of cell differentiation [inference]

regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation [inference]

negative regulation of hepatocyte differentiation

regulation of hepatocyte differentiation [inference]

negative regulation of hepatocyte differentiation

negative regulation of cell differentiation [inference]

negative regulation of cell development

negative regulation of epithelial cell differentiation [inference]

negative regulation of hepatocyte differentiation

positive regulation of cell differentiation [inference]

positive regulation of fat cell differentiation

regulation of fat cell differentiation [inference]

positive regulation of fat cell differentiation

regulation of cell development [inference]

negative regulation of cell development

positive regulation of cellular process [inference]

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of cell differentiation [inference]

positive regulation of fat cell differentiation

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

negative regulation of cell growth

negative regulation of cell differentiation [inference]

negative regulation of cell development

negative regulation of epithelial cell differentiation [inference]

negative regulation of hepatocyte differentiation

regulation of cellular component organization [inference]

regulation of cell growth [inference]

negative regulation of cell growth

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

regulation of multicellular organismal development [inference]

regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation [inference]

negative regulation of hepatocyte differentiation

regulation of hepatocyte differentiation [inference]

negative regulation of hepatocyte differentiation

regulation of cartilage development [inference]

negative regulation of cartilage development

Displaying **all 3** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
cytoplasm	IBA	GO_REF
membrane	TAS	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

Displaying **all 4** entries
GO Term	Evidence Code	Reference
Wnt-protein binding	ISS	GO_REF
Wnt-protein binding	NAS	PMID
Wnt-protein binding	IBA	GO_REF
Wnt-protein binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

Wnt-protein binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVCGSPGGMLLLRAGLLALAALCLLRVPGARAAACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
49	N-linked (GlcNAc...) asparagine	29741879 37074911	G90382BL G34989PA G22310AV G45395BF G59324HL G43223CG G82830MN G83460ZZ G41071NU G80920RR	UniProt GlyGen GlyConnect