GlyCosmos Portal

Submissions

Lipase lipl-4

Summary

UniProt ID: Q94252
Gene Symbol: K04A8.5 lipl-4
Gene ID: 179046
Organism: Caenorhabditis elegans

External Links

Re-Glyco: Q94252

Annotation

Keyword: Alternative splicing Glycoprotein Hydrolase Lipid degradation Lysosome Reference proteome Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
lipid metabolic process	IBA	GO_REF
lipid metabolic process	IEA	GO_REF
determination of adult lifespan	IMP	PMID
positive regulation of autophagy	IDA	PMID
positive regulation of macroautophagy	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

lipid catabolic process [inference]

glycerolipid catabolic process [inference]

acylglycerol catabolic process [inference]

triglyceride catabolic process

biosynthetic process [inference]

lipid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

long-chain fatty acid biosynthetic process

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

long-chain fatty acid biosynthetic process

primary metabolic process [inference]

lipid metabolic process

fatty acid metabolic process [inference]

long-chain fatty acid metabolic process [inference]

long-chain fatty acid biosynthetic process

fatty acid biosynthetic process [inference]

long-chain fatty acid biosynthetic process

neutral lipid metabolic process [inference]

acylglycerol metabolic process [inference]

triglyceride metabolic process [inference]

triglyceride catabolic process

acylglycerol catabolic process [inference]

triglyceride catabolic process

neutral lipid catabolic process [inference]

acylglycerol catabolic process [inference]

triglyceride catabolic process

lipid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

long-chain fatty acid biosynthetic process

lipid catabolic process [inference]

glycerolipid catabolic process [inference]

acylglycerol catabolic process [inference]

triglyceride catabolic process

glycerolipid metabolic process [inference]

acylglycerol metabolic process [inference]

triglyceride metabolic process [inference]

triglyceride catabolic process

acylglycerol catabolic process [inference]

triglyceride catabolic process

glycerolipid catabolic process [inference]

acylglycerol catabolic process [inference]

triglyceride catabolic process

small molecule metabolic process [inference]

organic acid metabolic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

long-chain fatty acid biosynthetic process

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

monocarboxylic acid metabolic process [inference]

fatty acid metabolic process [inference]

long-chain fatty acid metabolic process [inference]

long-chain fatty acid biosynthetic process

fatty acid biosynthetic process [inference]

long-chain fatty acid biosynthetic process

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

long-chain fatty acid biosynthetic process

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

long-chain fatty acid biosynthetic process

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

long-chain fatty acid biosynthetic process

multicellular organismal process [inference]

determination of adult lifespan

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of autophagy

positive regulation of macroautophagy

regulation of cellular process [inference]

regulation of metabolic process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of autophagy

positive regulation of macroautophagy

regulation of catabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of autophagy

positive regulation of macroautophagy

regulation of autophagy [inference]

positive regulation of autophagy

positive regulation of macroautophagy

regulation of macroautophagy [inference]

positive regulation of macroautophagy

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of autophagy

positive regulation of macroautophagy

Displaying **all 4** entries
GO Term	Evidence Code	Reference
cytoplasm	IDA	PMID
lysosome	IDA	PMID
lysosomal lumen	EXP	PMID
lysosomal lumen	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

vacuolar lumen [inference]

lysosomal lumen

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

Displaying **all 3** entries
GO Term	Evidence Code	Reference
triacylglycerol lipase activity	IMP	PMID
triacylglycerol lipase activity	IEA	GO_REF GO_REF
lipase activity

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

lipase activity

triacylglycerol lipase activity

carboxylic ester hydrolase activity [inference]

triacylglycerol lipase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MRESISDLMTVMIPLLIILLLSNYSKSVDLEFYLDTPELIKSWGYSVEIYNTTTKDGFILELHRIPYGREVPTSSDVNNSRPVIFLQHGFLCSSFDWVANSPHQSAGFVFADAGFDVWLGNFRGNTYSRKHVSLNPDKDPKFWDWSWDQISEYDLPAMIGKALEISGQESLYYTGFSLGTLTMFAKLSTDPKFSRKIKKYFALAPIGSIKHAHGVFLFLGRHFGKDYEEYVKKHGSDELFGSSLLFKKIVKYTCGLFDTLEEFCSDITLLFIGTANENWNQTRIPVYLAHTPAGSSSNVMAHLDQMFSYGGVPTFDMGEEKNLKAYGQKLPPQYNFTGIADVPIYLFWSDDDWLSTKQDLEETLFAQLNSQVVQGSFRIENYNHLHFIWGTNAASQVYNVITGIILQDDNT

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	Source
51	N-linked (GlcNAc...) asparagine	UniProt
78	N-linked (GlcNAc...) asparagine	UniProt
280	N-linked (GlcNAc...) asparagine	UniProt
335	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Digestion of dietary lipid	Caenorhabditis elegans
Formation of the cornified envelope	Caenorhabditis elegans

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements