GlyCosmos Portal

Submissions

Cytokine receptor common subunit gamma

Summary

UniProt ID: Q95118
Gene Symbol: IL2RG
Gene ID: 281862
Organism: Bos taurus (domestic cattle)

External Links

PubChem: Q95118
Re-Glyco: Q95118

Annotation

Keyword: Cell membrane Disulfide bond Glycoprotein Phosphoprotein Receptor Reference proteome Signal Transmembrane helix

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
positive regulation of immunoglobulin production
cytokine-mediated signaling pathway	IBA	GO_REF
lymphocyte differentiation	IBA	GO_REF
interleukin-15-mediated signaling pathway	ISS	GO_REF
positive regulation of phagocytosis	ISS	GO_REF

GO Hierarchy

biological process

immune system process [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway

interleukin-15-mediated signaling pathway

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

mononuclear cell differentiation [inference]

lymphocyte differentiation

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

mononuclear cell differentiation [inference]

lymphocyte differentiation

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of immune effector process [inference]

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of localization [inference]

regulation of transport [inference]

positive regulation of transport [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

positive regulation of phagocytosis

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

positive regulation of transport [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway

interleukin-15-mediated signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of cellular component organization [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

positive regulation of phagocytosis

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

positive regulation of phagocytosis

Displaying **all 4** entries
GO Term	Evidence Code	Reference
external side of plasma membrane	IBA	GO_REF
cell surface	ISS	GO_REF
cell surface	IEA	GO_REF GO_REF
signaling receptor complex	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex

cellular anatomical structure [inference]

cell surface

side of membrane [inference]

external side of plasma membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
cytokine receptor activity	IBA	GO_REF
cytokine receptor activity	IEA	GO_REF
cytokine binding	IBA	GO_REF
interleukin-15 receptor activity	ISS	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

cytokine binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

cytokine receptor activity

interleukin-15 receptor activity

immune receptor activity [inference]

cytokine receptor activity

interleukin-15 receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLKPPLPLRSLLFLQLPLLGVGLNPKFLTPSGNEDIGGKPGTGGDFFLTSTPAGTLDVSTLPLPKVQCFVFNVEYMNCTWNSSSEPQPNNLTLHYGYRNFNGDDKLQECGHYLFSEGITSGCWFGKKEIRLYETFVVQLQDPREHRKQPKQMLKLQDLVIPWAPENLTLRNLSEFQLELSWSNRYLDHCLEHLVQYRSDRDRSWTEQSVDHRHSFSLPSVDAQKLYTFRVRSRYNPLCGSAQHWSDWSYPIHWGSNTSKENIENPENPSLFALEAVLIPLGSMGLIVSLICVYCWLERTMPRIPTLKNLEDLVTEYQGNFSAWSGVSKGLAESLQPDYSERLCHVSEIPPKGGEGPGGSPCSQHSPYWAPPCYTLKPEP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	Source
77	N-linked (GlcNAc...) asparagine	UniProt
81	N-linked (GlcNAc...) asparagine	UniProt
90	N-linked (GlcNAc...) asparagine	UniProt
166	N-linked (GlcNAc...) asparagine	UniProt
171	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 8** entries
Pathway Name	Organism
Interleukin receptor SHC signaling	Bos taurus
Interleukin-15 signaling	Bos taurus
Interleukin-2 signaling	Bos taurus
Interleukin-21 signaling	Bos taurus
Interleukin-4 and Interleukin-13 signaling	Bos taurus
Interleukin-7 signaling	Bos taurus
Interleukin-9 signaling	Bos taurus
RAF/MAP kinase cascade	Bos taurus