GlyCosmos Portal

Submissions

Interleukin-6

Summary

UniProt ID: Q95181
Gene Symbol: IL6
Gene ID: 100034196
Organism: Equus caballus (horse)

External Links

PubChem: Q95181
Re-Glyco: Q95181

Annotation

Keyword: Acute phase Cytokine Disulfide bond Glycoprotein Growth factor Phosphoprotein Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
acute-phase response
inflammatory response	IBA	GO_REF
vascular endothelial growth factor production	ISS	GO_REF
response to activity	ISS	GO_REF
glucose homeostasis	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

interleukin-6-mediated signaling pathway

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

gene expression [inference]

cytokine production [inference]

vascular endothelial growth factor production

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

gene expression [inference]

cytokine production [inference]

vascular endothelial growth factor production

cell population proliferation [inference]

epithelial cell proliferation [inference]

hepatocyte proliferation

cellular developmental process [inference]

cell fate commitment [inference]

T cell lineage commitment [inference]

alpha-beta T cell lineage commitment [inference]

CD4-positive, alpha-beta T cell lineage commitment [inference]

T-helper cell lineage commitment [inference]

T-helper 17 cell lineage commitment

CD4-positive or CD8-positive, alpha-beta T cell lineage commitment [inference]

CD4-positive, alpha-beta T cell lineage commitment [inference]

T-helper cell lineage commitment [inference]

T-helper 17 cell lineage commitment

multicellular organismal process [inference]

cytokine production [inference]

vascular endothelial growth factor production

developmental process [inference]

anatomical structure development [inference]

regeneration [inference]

animal organ regeneration [inference]

liver regeneration

animal organ development [inference]

animal organ regeneration [inference]

liver regeneration

gland development [inference]

liver development [inference]

liver regeneration

cellular developmental process [inference]

cell fate commitment [inference]

T cell lineage commitment [inference]

alpha-beta T cell lineage commitment [inference]

CD4-positive, alpha-beta T cell lineage commitment [inference]

T-helper cell lineage commitment [inference]

T-helper 17 cell lineage commitment

CD4-positive or CD8-positive, alpha-beta T cell lineage commitment [inference]

CD4-positive, alpha-beta T cell lineage commitment [inference]

T-helper cell lineage commitment [inference]

T-helper 17 cell lineage commitment

homeostatic process [inference]

chemical homeostasis [inference]

carbohydrate homeostasis [inference]

glucose homeostasis

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response

acute inflammatory response [inference]

acute-phase response

response to activity

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT

regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via STAT

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT

regulation of hormone secretion [inference]

regulation of peptide hormone secretion [inference]

regulation of localization [inference]

regulation of protein localization [inference]

regulation of establishment of protein localization [inference]

regulation of protein transport [inference]

regulation of protein secretion [inference]

regulation of insulin secretion

regulation of transport [inference]

regulation of secretion [inference]

regulation of peptide secretion [inference]

regulation of peptide hormone secretion [inference]

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

regulation of peptide hormone secretion [inference]

regulation of protein secretion [inference]

regulation of insulin secretion

regulation of protein transport [inference]

regulation of protein secretion [inference]

regulation of insulin secretion

regulation of peptide transport [inference]

regulation of peptide secretion [inference]

regulation of peptide hormone secretion [inference]

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT

positive regulation of multicellular organismal process

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT

regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via STAT

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

interleukin-6-mediated signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT

regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via STAT

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT

regulation of hormone secretion [inference]

regulation of peptide hormone secretion [inference]

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

regulation of peptide hormone secretion [inference]

regulation of protein secretion [inference]

regulation of insulin secretion

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process

regulation of biological quality [inference]

regulation of hormone levels [inference]

regulation of hormone secretion [inference]

regulation of peptide hormone secretion [inference]

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying **all 4** entries
GO Term	Evidence Code	Reference
cytokine activity	IBA	GO_REF
cytokine activity	IEA	GO_REF
interleukin-6 receptor binding	IEA	GO_REF
growth factor activity

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

interleukin-6 receptor binding

growth factor receptor binding [inference]

interleukin-6 receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MNSLSTSTVTPVAFSLGLLLVMATAFPTPLPLGEDETTSNGPLLTTADKTKQHIKYILGKISALKNEMCNNFSKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMKITTGLSEFQIYLEYLQNEFKGEKENIKTMQISTKVLVQILMQKMKNPEVTTPDPTAKSSLLAKLHSQNEWLKNTTTHLILRSLEDFLQFSLRAVRIM

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites