GlyCosmos Portal

Submissions

Interleukin-13

Summary

UniProt ID

Q95J68

Gene Symbol

IL13

Gene ID

[396721]

Organism

Sus scrofa (pig)

External Links

PubChem: Q95J68
Re-Glyco: Q95J68

Annotation

Keyword: Cytokine Disulfide bond Glycoprotein Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
positive regulation of immunoglobulin production	IBA	GO_REF
inflammatory response	IBA	GO_REF
immune response	IEA	GO_REF
transforming growth factor beta receptor signaling pathway
response to nematode

GO Hierarchy

biological process

immune system process [inference]

immune response

leukocyte activation [inference]

myeloid leukocyte activation [inference]

macrophage activation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

myeloid leukocyte activation [inference]

macrophage activation

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

transforming growth factor beta receptor signaling pathway

cytokine-mediated signaling pathway [inference]

interleukin-13-mediated signaling pathway

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

gene expression [inference]

cytokine production [inference]

transforming growth factor beta production [inference]

transforming growth factor beta1 production

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

gene expression [inference]

cytokine production [inference]

transforming growth factor beta production [inference]

transforming growth factor beta1 production

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

myeloid leukocyte activation [inference]

macrophage activation

cytokine production [inference]

transforming growth factor beta production [inference]

transforming growth factor beta1 production

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to nematode

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response

immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to nematode

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to nematode

response to chemical [inference]

response to selenium ion

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of macrophage activation

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of macrophage activation

regulation of macrophage activation [inference]

positive regulation of macrophage activation

regulation of immune effector process [inference]

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of leukocyte mediated immunity [inference]

regulation of myeloid leukocyte mediated immunity [inference]

regulation of mast cell degranulation [inference]

positive regulation of mast cell degranulation

regulation of leukocyte degranulation [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of mast cell degranulation [inference]

positive regulation of mast cell degranulation

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of regulated secretory pathway [inference]

regulation of leukocyte degranulation [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of mast cell degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of regulated secretory pathway [inference]

regulation of leukocyte degranulation [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of mast cell degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of macrophage activation

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of macrophage activation

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of macrophage activation

positive regulation of cold-induced thermogenesis

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell killing [inference]

negative regulation of complement-dependent cytotoxicity

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of endothelial cell apoptotic process

negative regulation of response to stimulus [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

regulation of inflammatory response [inference]

negative regulation of inflammatory response

negative regulation of response to stimulus [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

regulation of response to stress [inference]

regulation of defense response [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response

regulation of inflammatory response [inference]

negative regulation of inflammatory response

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

transforming growth factor beta receptor signaling pathway

cytokine-mediated signaling pathway [inference]

interleukin-13-mediated signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

regulation of interleukin-10 production [inference]

positive regulation of interleukin-10 production

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

regulation of interleukin-10 production [inference]

positive regulation of interleukin-10 production

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of cell killing [inference]

negative regulation of cell killing [inference]

negative regulation of complement-dependent cytotoxicity

regulation of complement-dependent cytotoxicity [inference]

negative regulation of complement-dependent cytotoxicity

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process [inference]

negative regulation of endothelial cell apoptotic process

regulation of endothelial cell apoptotic process [inference]

negative regulation of endothelial cell apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of endothelial cell apoptotic process

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of macrophage activation

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

negative regulation of cellular process [inference]

negative regulation of cell killing [inference]

negative regulation of complement-dependent cytotoxicity

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of endothelial cell apoptotic process

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of macrophage activation

regulation of macrophage activation [inference]

positive regulation of macrophage activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of macrophage activation

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of regulated secretory pathway [inference]

regulation of leukocyte degranulation [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of mast cell degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of regulated secretory pathway [inference]

regulation of leukocyte degranulation [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of mast cell degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

regulation of interleukin-10 production [inference]

positive regulation of interleukin-10 production

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of macrophage activation

regulation of macrophage activation [inference]

positive regulation of macrophage activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of macrophage activation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-10 production

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of macrophage activation

positive regulation of cold-induced thermogenesis

regulation of cold-induced thermogenesis [inference]

positive regulation of cold-induced thermogenesis

Displaying **all 3** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
cytoplasm	IEA	GO_REF
external side of plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

side of membrane [inference]

external side of plasma membrane

Displaying **all 2** entries
GO Term	Evidence Code	Reference
cytokine activity	IEA	GO_REF
interleukin-13 receptor binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

interleukin-13 receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MALWLTLVIALTCFGGLASPGPVPPHSTALKELIEELVNITQNQKTPLCNGSMVWSVNLTTSMQYCAALESLINISDCSAIQKTQRMLSALCSHKPPSEQVPGKHIRDTKIEVAQFVKDLLKHLRMIFRHG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	Source
39	N-linked (GlcNAc...) asparagine	UniProt
50	N-linked (GlcNAc...) asparagine	UniProt
58	N-linked (GlcNAc...) asparagine	UniProt
74	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Interleukin-4 and Interleukin-13 signaling	Sus scrofa

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements