GlyCosmos Portal

Submissions

Metalloproteinase inhibitor 1

Summary

UniProt ID: Q95KL9
Gene Symbol: TIMP1
Gene ID: 574348
Organism: Macaca mulatta (Rhesus monkey)

External Links

PubChem: Q95KL9
Re-Glyco: Q95KL9

Annotation

Keyword: Disulfide bond Glycoprotein Growth factor Metal-binding Metalloprotease inhibitor Phosphoprotein Reference proteome Secreted Signal Zinc

Gene Ontology (GO)

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
connective tissue replacement involved in inflammatory response wound healing
positive regulation of cell population proliferation	ISS	GO_REF
positive regulation of cell population proliferation	IEA	GO_REF
response to hormone	IBA	GO_REF
negative regulation of endopeptidase activity	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cellular response to stimulus [inference]

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

multicellular organismal process [inference]

tissue remodeling [inference]

connective tissue replacement [inference]

connective tissue replacement involved in inflammatory response wound healing

response to stimulus [inference]

response to abiotic stimulus [inference]

response to radiation [inference]

response to light stimulus [inference]

response to UV [inference]

cellular response to UV [inference]

cellular response to UV-A

response to UV-A [inference]

cellular response to UV-A

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

response to endogenous stimulus [inference]

response to hormone

response to chemical [inference]

response to hormone

response to peptide [inference]

response to cytokine

cellular response to stimulus [inference]

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of integrin-mediated signaling pathway

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of trophoblast cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration [inference]

negative regulation of trophoblast cell migration

regulation of trophoblast cell migration [inference]

negative regulation of trophoblast cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of trophoblast cell migration

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

negative regulation of biological process [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of trophoblast cell migration

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of peptidase activity [inference]

negative regulation of endopeptidase activity

negative regulation of membrane protein ectodomain proteolysis

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of trophoblast cell migration

negative regulation of multicellular organismal process [inference]

negative regulation of trophoblast cell migration

negative regulation of reproductive process [inference]

negative regulation of trophoblast cell migration

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of integrin-mediated signaling pathway

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of integrin-mediated signaling pathway

regulation of metabolic process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of peptidase activity [inference]

negative regulation of endopeptidase activity

negative regulation of membrane protein ectodomain proteolysis

regulation of catabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of peptidase activity [inference]

negative regulation of endopeptidase activity

negative regulation of membrane protein ectodomain proteolysis

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

negative regulation of proteolysis [inference]

negative regulation of peptidase activity [inference]

negative regulation of endopeptidase activity

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of peptidase activity [inference]

negative regulation of peptidase activity [inference]

negative regulation of endopeptidase activity

regulation of endopeptidase activity [inference]

negative regulation of endopeptidase activity

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of peptidase activity [inference]

negative regulation of endopeptidase activity

negative regulation of membrane protein ectodomain proteolysis

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

negative regulation of proteolysis [inference]

negative regulation of peptidase activity [inference]

negative regulation of endopeptidase activity

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of peptidase activity [inference]

negative regulation of peptidase activity [inference]

negative regulation of endopeptidase activity

regulation of endopeptidase activity [inference]

negative regulation of endopeptidase activity

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of peptidase activity [inference]

negative regulation of endopeptidase activity

negative regulation of membrane protein ectodomain proteolysis

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of peptidase activity [inference]

negative regulation of endopeptidase activity

negative regulation of membrane protein ectodomain proteolysis

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of trophoblast cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration [inference]

negative regulation of trophoblast cell migration

regulation of trophoblast cell migration [inference]

negative regulation of trophoblast cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of trophoblast cell migration

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of trophoblast cell migration

regulation of reproductive process [inference]

negative regulation of reproductive process [inference]

negative regulation of trophoblast cell migration

regulation of molecular function [inference]

negative regulation of molecular function [inference]

negative regulation of catalytic activity

negative regulation of hydrolase activity [inference]

negative regulation of peptidase activity [inference]

negative regulation of endopeptidase activity

regulation of catalytic activity [inference]

negative regulation of catalytic activity

negative regulation of hydrolase activity [inference]

negative regulation of peptidase activity [inference]

negative regulation of endopeptidase activity

regulation of hydrolase activity [inference]

negative regulation of hydrolase activity [inference]

negative regulation of peptidase activity [inference]

negative regulation of endopeptidase activity

regulation of peptidase activity [inference]

negative regulation of peptidase activity [inference]

negative regulation of endopeptidase activity

regulation of endopeptidase activity [inference]

negative regulation of endopeptidase activity

Displaying **all 5** entries
GO Term	Evidence Code	Reference
basement membrane	IEA	GO_REF
obsolete extracellular space
extracellular matrix	IBA	GO_REF
extracellular matrix	IEA	GO_REF
secretory granule lumen	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

external encapsulating structure [inference]

extracellular matrix

basement membrane

membrane-enclosed lumen [inference]

organelle lumen [inference]

vesicle lumen [inference]

cytoplasmic vesicle lumen [inference]

secretory granule lumen

intracellular organelle lumen [inference]

cytoplasmic vesicle lumen [inference]

secretory granule lumen

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cytokine activity	ISS	GO_REF
cytokine activity	IEA	GO_REF
growth factor activity
metalloendopeptidase inhibitor activity	ISS	GO_REF
metalloendopeptidase inhibitor activity	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

peptidase regulator activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

endopeptidase regulator activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function inhibitor activity [inference]

enzyme inhibitor activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAPFEPLASGILLLLWLIAPSRACTCVLPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRTRMA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
53	N-linked (GlcNAc...) asparagine			UniProt
101	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements