GlyCosmos Portal

Submissions

Fibroblast growth factor 9

Summary

UniProt ID

Q95L12

Gene Symbol

FGF9

Gene ID

[396717]

Organism

Sus scrofa (pig)

External Links

PubChem: Q95L12
Re-Glyco: Q95L12

Annotation

Keyword: Developmental protein Differentiation Glycoprotein Growth factor Heparin-binding Mitogen Reference proteome Secreted

Gene Ontology (GO)

Displaying entries **1 - 5** of 39 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of transcription by RNA polymerase II
angiogenesis
osteoblast differentiation
eye development
positive regulation of mesenchymal cell proliferation

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

activin receptor signaling pathway

smoothened signaling pathway

Wnt signaling pathway [inference]

canonical Wnt signaling pathway

cell population proliferation [inference]

mesenchymal cell proliferation

muscle cell proliferation [inference]

striated muscle cell proliferation [inference]

cardiac muscle cell proliferation

epithelial cell proliferation [inference]

Sertoli cell proliferation

stem cell proliferation

intercellular transport [inference]

import into nucleus [inference]

protein import into nucleus

cellular developmental process [inference]

cell differentiation [inference]

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

reproductive process [inference]

developmental process involved in reproduction [inference]

sex determination [inference]

male sex determination

developmental process [inference]

developmental process involved in reproduction [inference]

sex determination [inference]

male sex determination

anatomical structure morphogenesis [inference]

appendage morphogenesis [inference]

limb morphogenesis [inference]

embryonic limb morphogenesis

embryonic appendage morphogenesis [inference]

embryonic limb morphogenesis

embryonic morphogenesis [inference]

embryonic appendage morphogenesis [inference]

embryonic limb morphogenesis

inner ear morphogenesis

anatomical structure formation involved in morphogenesis [inference]

angiogenesis

anatomical structure development [inference]

tissue development [inference]

mesenchyme development [inference]

lung-associated mesenchyme development

tube development [inference]

digestive tract development [inference]

embryonic digestive tract development

animal organ development [inference]

sensory organ development [inference]

eye development

embryonic organ development [inference]

embryonic digestive tract development

system development [inference]

skeletal system development [inference]

embryonic skeletal system development

cellular developmental process [inference]

cell differentiation [inference]

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein import into nucleus

protein localization to organelle [inference]

protein localization to nucleus [inference]

protein import into nucleus

establishment of localization [inference]

transport [inference]

intercellular transport [inference]

import into nucleus [inference]

protein import into nucleus

protein transport [inference]

intracellular protein transport [inference]

protein import into nucleus

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

establishment of protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein import into nucleus

establishment of protein localization to organelle [inference]

protein import into nucleus

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of smoothened signaling pathway [inference]

positive regulation of smoothened signaling pathway

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

negative regulation of Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

regulation of vascular endothelial growth factor receptor signaling pathway [inference]

positive regulation of vascular endothelial growth factor receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of activin receptor signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

signaling [inference]

cell-cell signaling

regulation of growth [inference]

positive regulation of growth [inference]

positive regulation of developmental growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of developmental growth [inference]

regulation of organ growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of developmental growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of locomotion [inference]

regulation of cell motility [inference]

regulation of cell migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of growth [inference]

positive regulation of developmental growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of mesenchymal cell proliferation

positive regulation of smooth muscle cell proliferation [inference]

positive regulation of vascular associated smooth muscle cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell division

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of developmental process [inference]

positive regulation of developmental growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of multicellular organismal process [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of smoothened signaling pathway [inference]

positive regulation of smoothened signaling pathway

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

negative regulation of Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

regulation of vascular endothelial growth factor receptor signaling pathway [inference]

positive regulation of vascular endothelial growth factor receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of activin receptor signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

regulation of cellular response to growth factor stimulus [inference]

regulation of vascular endothelial growth factor receptor signaling pathway [inference]

positive regulation of vascular endothelial growth factor receptor signaling pathway

regulation of developmental process [inference]

regulation of development, heterochronic [inference]

regulation of timing of cell differentiation

regulation of cell differentiation [inference]

regulation of timing of cell differentiation

regulation of developmental growth [inference]

regulation of organ growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of developmental growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of developmental process [inference]

positive regulation of developmental growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of multicellular organismal development [inference]

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

activin receptor signaling pathway

smoothened signaling pathway

Wnt signaling pathway [inference]

canonical Wnt signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of smoothened signaling pathway [inference]

positive regulation of smoothened signaling pathway

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

negative regulation of Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

regulation of vascular endothelial growth factor receptor signaling pathway [inference]

positive regulation of vascular endothelial growth factor receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of activin receptor signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of mesenchymal cell proliferation

positive regulation of smooth muscle cell proliferation [inference]

positive regulation of vascular associated smooth muscle cell proliferation

regulation of mesenchymal cell proliferation [inference]

positive regulation of mesenchymal cell proliferation

regulation of smooth muscle cell proliferation [inference]

positive regulation of smooth muscle cell proliferation [inference]

positive regulation of vascular associated smooth muscle cell proliferation

regulation of vascular associated smooth muscle cell proliferation [inference]

positive regulation of vascular associated smooth muscle cell proliferation

regulation of epithelial cell proliferation [inference]

positive regulation of epithelial cell proliferation

regulation of cardiac muscle cell proliferation [inference]

positive regulation of cardiac muscle cell proliferation

regulation of stem cell proliferation [inference]

positive regulation of stem cell proliferation

regulation of cell differentiation [inference]

regulation of timing of cell differentiation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of mesenchymal cell proliferation

positive regulation of smooth muscle cell proliferation [inference]

positive regulation of vascular associated smooth muscle cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell division

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

regulation of cell division [inference]

positive regulation of cell division

regulation of cell motility [inference]

regulation of cell migration

regulation of multicellular organismal process [inference]

regulation of organ growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of multicellular organismal process [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of multicellular organismal development [inference]

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

Displaying **all 2** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
cytoplasm	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

Displaying **all 4** entries
GO Term	Evidence Code	Reference
fibroblast growth factor receptor binding	IBA	GO_REF
growth factor activity	IBA	GO_REF
growth factor activity	IEA	GO_REF
heparin binding

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

growth factor receptor binding [inference]

fibroblast growth factor receptor binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

heparin binding

sulfur compound binding [inference]

heparin binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

growth factor activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

growth factor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLSQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRFYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
79	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 17 in total

1

2

Next ›

Last »
Pathway Name	Organism
Downstream signaling of activated FGFR1	Sus scrofa
FGFR1c ligand binding and activation	Sus scrofa
FGFR4 ligand binding and activation	Sus scrofa
FRS-mediated FGFR1 signaling	Sus scrofa
FRS-mediated FGFR4 signaling	Sus scrofa
Negative regulation of FGFR1 signaling	Sus scrofa
Negative regulation of FGFR4 signaling	Sus scrofa
PI-3K cascade:FGFR1	Sus scrofa
PI-3K cascade:FGFR4	Sus scrofa
PI3K Cascade	Sus scrofa

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements