GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Glycosaminoglycan xylosylkinase homolog

Summary

UniProt ID: Q95T10
Gene Symbol: CG3631
Gene ID: 41797
Organism: Drosophila melanogaster (fruit fly)

External Links

Re-Glyco: Q95T10

Annotation

Keyword: ATP-binding Disulfide bond Endoplasmic reticulum Glycoprotein Golgi apparatus Kinase Manganese Metal-binding Reference proteome Signal

Gene Ontology (GO)

Displaying 1 entry
GO Term	Evidence Code	Reference
proteoglycan biosynthetic process	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

proteoglycan biosynthetic process

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

proteoglycan biosynthetic process

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

proteoglycan biosynthetic process

protein metabolic process [inference]

glycoprotein metabolic process [inference]

proteoglycan metabolic process [inference]

proteoglycan biosynthetic process

glycoprotein biosynthetic process [inference]

proteoglycan biosynthetic process

primary metabolic process [inference]

protein metabolic process [inference]

glycoprotein metabolic process [inference]

proteoglycan metabolic process [inference]

proteoglycan biosynthetic process

glycoprotein biosynthetic process [inference]

proteoglycan biosynthetic process

carbohydrate derivative metabolic process [inference]

glycoprotein metabolic process [inference]

proteoglycan metabolic process [inference]

proteoglycan biosynthetic process

glycoprotein biosynthetic process [inference]

proteoglycan biosynthetic process

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

proteoglycan biosynthetic process

Displaying **all 4** entries
GO Term	Evidence Code	Reference
endoplasmic reticulum	IDA	PMID
endoplasmic reticulum	IEA	GO_REF
Golgi apparatus	IDA	PMID
Golgi apparatus	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Displaying **all 4** entries
GO Term	Evidence Code	Reference
protein serine/threonine kinase activity	ISS	PMID
ATP binding
phosphotransferase activity, alcohol group as acceptor	IBA	GO_REF
metal ion binding

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring phosphorus-containing groups [inference]

kinase activity [inference]

protein kinase activity [inference]

protein serine/threonine kinase activity

phosphotransferase activity, alcohol group as acceptor

protein kinase activity [inference]

protein serine/threonine kinase activity

catalytic activity, acting on a protein [inference]

protein kinase activity [inference]

protein serine/threonine kinase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

cation binding [inference]

metal ion binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MNKRSVIIAGIVASLLGLALGANFYFMYYLSAEEGHLASVRALENMIRHKMRHLKPNYLNRNPRFFMFRNKLLKNYKAAPYENASVLWDIANWWPHENEVYPLYDSSMGQLLETLRREPITRVSNLGRGTQLKLLVRLSHQQKVIFKPQWYPREEVIDGMIYSGKDRHTAEVYAFYLGAVLDFRWTPIVVGRVVNLKKEIYAKGDPELQQTINIETDEDGREKYCLFGKCHYCNEEETVCGDERHNIEGVLIYIVPGTLAKRRSPWQRTYKDDKRAPWEDDMTYCKSLKNKMETIRLLDLIDASIFDYLIQNGDRHHYETREERVVLIDNGKAFGNPNKDHLDILAPLYQCCLLRKSTWDRLQVFSGGVLTEIIDRLSKQDALYPLITDKHKKGVERRLLVVYAVVEHCMDIEGDKMFKTL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
83	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Glycosaminoglycan-protein linkage region biosynthesis	Drosophila melanogaster

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026